SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0021
         (673 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2||...    27   3.3  
SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    26   4.3  
SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual     25   7.5  
SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst...    25   7.5  
SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosacch...    25   7.5  
SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb...    25   9.9  
SPBC800.02 |whi5|mug54|cell cycle transcriptional repressor Whi5...    25   9.9  
SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein S10|Schizosa...    25   9.9  

>SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 525

 Score = 26.6 bits (56), Expect = 3.3
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -2

Query: 663 LCVLNIWIKPALPFAPREVSVLSE 592
           LCV ++WIK A  F+ R  S + E
Sbjct: 414 LCVTDVWIKKATAFSKRRQSQVFE 437


>SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 682

 Score = 26.2 bits (55), Expect = 4.3
 Identities = 15/56 (26%), Positives = 23/56 (41%)
 Frame = -2

Query: 672 SQSLCVLNIWIKPALPFAPREVSVLSELALGHLRYSLTDVPPQSNSPPGSVLEPDT 505
           S S    N  + P +   P  V+ +S  +  HL       P  S+ PP   ++P T
Sbjct: 145 SSSSTTSNPNVAPPISTLPDPVATISSSSSSHLDMGAIHPPHHSSLPPHMGVDPST 200


>SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1029

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = +1

Query: 604 RNLAWSKGQSWLDPDVQY 657
           + + W++GQ WL P V Y
Sbjct: 307 QTILWTQGQLWLSPRVLY 324


>SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit
           Pst2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1075

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 10/27 (37%), Positives = 19/27 (70%)
 Frame = -2

Query: 144 GYLKRVIVTPAVYPRLLEFLHVDIQST 64
           G+++R+ V    YP LLE+L++ + S+
Sbjct: 76  GFIERISVILRDYPDLLEYLNIFLPSS 102


>SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 474

 Score = 25.4 bits (53), Expect = 7.5
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +2

Query: 581 PKASSERTETSRGAKGKAGLIQMFSTH 661
           P+  S +TET  G KGKA   +M   H
Sbjct: 18  PQGPSIKTETIPGPKGKAAAEEMSKYH 44


>SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 2685

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = -2

Query: 138  LKRVIVTPAVYPRLLEFLHVDIQSTGQKSHC 46
            L + IVT + + RLLE+L  D  S  Q S C
Sbjct: 1789 LTKRIVTLSDHYRLLEYLLKDESSCSQASQC 1819


>SPBC800.02 |whi5|mug54|cell cycle transcriptional repressor
           Whi5|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 252

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = -3

Query: 326 YATPLMSPYNARLXSSSTGSSFPAILPSPFPWL 228
           Y  P+ SPY++    SST SSF    P   PWL
Sbjct: 132 YKKPV-SPYSSSSAVSSTSSSFDRTSP---PWL 160


>SPAC31G5.17c |rps1001|rps10-1|40S ribosomal protein
           S10|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 144

 Score = 25.0 bits (52), Expect = 9.9
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = +3

Query: 195 PTVPIYYLAKPQPRERAWENSGERR 269
           PT P     +P+PRERA  ++G RR
Sbjct: 97  PTAP--RAGRPEPRERASADAGYRR 119


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,889,994
Number of Sequences: 5004
Number of extensions: 60246
Number of successful extensions: 142
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 138
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 142
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 307866294
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).