SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0014
         (389 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC330.03c |||NADPH-hemoprotein reductase|Schizosaccharomyces p...    27   0.77 
SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb...    27   1.0  
SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces...    27   1.0  
SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr 2|||Ma...    26   2.4  
SPBPB10D8.01 |||cysteine transporter |Schizosaccharomyces pombe|...    25   3.1  
SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22...    25   5.5  
SPAC959.06c |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    25   5.5  
SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|...    24   7.2  
SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ...    24   7.2  
SPBC11C11.11c ||SPBC3B8.12|ATP-dependent DNA helicase Irc3 |Schi...    24   9.5  
SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|ch...    24   9.5  
SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|c...    24   9.5  

>SPCC330.03c |||NADPH-hemoprotein reductase|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 145

 Score = 27.5 bits (58), Expect = 0.77
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 2/107 (1%)
 Frame = -1

Query: 341 NKFKIPPYYFRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEVQTS 162
           NK+KIPP + ++     ++      G   V   IS   EEL     P + W +      +
Sbjct: 40  NKYKIPPGHTQQDWDALVASGKNLSG---VESPISVTAEELAKHCSPDDCWMAIRGKVYN 96

Query: 161 VQSYCVYYP-GEGRLFSHLLSSSA*RRNESGPPKRHHD-VIWSEILK 27
           V +Y  Y+P G  ++  H   S     + + P  +HHD V   E+LK
Sbjct: 97  VTAYLPYHPVGPKKILKH---SGV---DATKPYLKHHDWVNEEELLK 137


>SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 2685

 Score = 27.1 bits (57), Expect = 1.0
 Identities = 11/47 (23%), Positives = 25/47 (53%)
 Frame = +2

Query: 152  KIEQMFELQHLKTKFPSAQKAQGAPQSSGKSHDEPRRHQNQRQSEKS 292
            +IEQ    +     FP+  ++ G P    ++HD+ + + +Q +++ S
Sbjct: 2356 QIEQELATKLFAYAFPNRNESDGFPHIYSRNHDKRKENGSQGEADNS 2402


>SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3699

 Score = 27.1 bits (57), Expect = 1.0
 Identities = 15/45 (33%), Positives = 25/45 (55%)
 Frame = +3

Query: 207  KKRKELLSHLGNLMTNQDGTKISGRARNRQEDDSSKVVWRYLELI 341
            K+ +++LS   N ++    T  +  A N+ ED  SK VW Y++ I
Sbjct: 3128 KRNEDILSIQSNFLSTNQST--NAPATNK-EDGLSKKVWEYIDEI 3169


>SPBC359.04c |||DIPSY family|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 358

 Score = 25.8 bits (54), Expect = 2.4
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +1

Query: 121 NRPSPG**TQ*D*TDV*TSASENQVSLGSKSARSSSVI 234
           N P PG  T    ++V ++ SEN    GSKS  SSS++
Sbjct: 49  NGPVPGTTTIYPTSNVASNTSENYPYTGSKSLSSSSIL 86


>SPBPB10D8.01 |||cysteine transporter |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 552

 Score = 25.4 bits (53), Expect = 3.1
 Identities = 13/54 (24%), Positives = 28/54 (51%)
 Frame = -1

Query: 326 PPYYFRRVVLLPISRSAADFGAVLVRHEISQMTEELLALFEPRETWFSDAEVQT 165
           P YY   +V + I+ S + F  +++R  + +  ++ LAL E  +  +    ++T
Sbjct: 468 PRYYPAWIVQIVIAWSVSPFVLLIIRWILVRRNKKRLALLEQNKEQYEKTWIET 521


>SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase
           Snf22|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1680

 Score = 24.6 bits (51), Expect = 5.5
 Identities = 12/30 (40%), Positives = 13/30 (43%)
 Frame = +2

Query: 197 PSAQKAQGAPQSSGKSHDEPRRHQNQRQSE 286
           PS    Q  PQ S    D P R  N R S+
Sbjct: 476 PSMPFQQNVPQMSSVKKDTPTRDANMRTSK 505


>SPAC959.06c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 225

 Score = 24.6 bits (51), Expect = 5.5
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%)
 Frame = +2

Query: 101 WTTDGKIIVLLPDNKRSKIEQMFE--LQHLKTKFP 199
           ++TD K++ + PDN     E  FE  L  LK + P
Sbjct: 155 FSTDSKVLFVWPDNDEFTREGTFETTLAKLKNRCP 189


>SPCC4G3.18 |||conserved fungal family|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 828

 Score = 24.2 bits (50), Expect = 7.2
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = +3

Query: 327 YLELIHRCNTKNLVIYS 377
           Y + +HRC T NL++ S
Sbjct: 279 YQKALHRCRTLNLILIS 295


>SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1213

 Score = 24.2 bits (50), Expect = 7.2
 Identities = 9/23 (39%), Positives = 18/23 (78%)
 Frame = -1

Query: 245 EISQMTEELLALFEPRETWFSDA 177
           ++SQM +E  +L+E R+++F+ A
Sbjct: 163 DLSQMRDEAKSLYEARKSYFTVA 185


>SPBC11C11.11c ||SPBC3B8.12|ATP-dependent DNA helicase Irc3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 606

 Score = 23.8 bits (49), Expect = 9.5
 Identities = 10/44 (22%), Positives = 21/44 (47%)
 Frame = -1

Query: 275 ADFGAVLVRHEISQMTEELLALFEPRETWFSDAEVQTSVQSYCV 144
           AD  + L + ++ +  +   A+FE    W   A  ++S   +C+
Sbjct: 230 ADSSSFLDQEKLKKEAQSEKAIFEIPRAWLEHASNRSSTLVFCI 273


>SPBC16A3.03c |lyn1||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 658

 Score = 23.8 bits (49), Expect = 9.5
 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = +3

Query: 285 RNRQEDDSSKVVWRYLELIHRCN-TKNLVIY 374
           +N++ED   ++  R+LE    CN T+  ++Y
Sbjct: 170 KNKKEDFLVELCLRFLERFRSCNLTEQAILY 200


>SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1687

 Score = 23.8 bits (49), Expect = 9.5
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = -3

Query: 171  SNICSILLRLLSGRRTIIFPSV 106
            SNIC I + +LS  R    PS+
Sbjct: 1447 SNICRITILMLSSPRDFFLPSL 1468


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,561,941
Number of Sequences: 5004
Number of extensions: 29318
Number of successful extensions: 97
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 94
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 97
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 128029482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).