SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC2F7.07c |||histone deacetylase complex subunit Rco1 |Schizos...    27   2.0  
SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c...    26   6.2  
SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual    26   6.2  
SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosacch...    26   6.2  
SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual      25   8.2  

>SPAC2F7.07c |||histone deacetylase complex subunit Rco1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 607

 Score = 27.5 bits (58), Expect = 2.0
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +2

Query: 38  RANYPLPAREVVTKNNDT 91
           +AN P+P  EVVT+NN T
Sbjct: 199 KANIPVPTSEVVTENNVT 216


>SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 288

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 14/54 (25%), Positives = 32/54 (59%), Gaps = 8/54 (14%)
 Frame = +1

Query: 499 SELQVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 636
           +E +++++   WGHS+ +V  E+L        +QD  E ++K+L ++ +S + +
Sbjct: 148 NEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201


>SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 978

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 529 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 636
           NW   +  ++G I  SSQ E    +L KV  SI +E
Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157


>SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 474

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 11/49 (22%), Positives = 23/49 (46%)
 Frame = -2

Query: 581 CDDPRISPLTSQYECPQLSLLIITWSSENQQNRTEIIFYYSMHEIFKQH 435
           C D ++  + + + CP ++ +I    SE   N     F++ +    K+H
Sbjct: 248 CID-QVEQILTNHHCPVVACIIEPIQSEGGDNHASPDFFHKLQATLKKH 295


>SPBC1685.06 |cid11||poly|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 478

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 6/14 (42%), Positives = 11/14 (78%)
 Frame = -3

Query: 73  HYLPCREWVICAPA 32
           HY+PC+ W++  P+
Sbjct: 455 HYIPCQSWLVWYPS 468


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,835,256
Number of Sequences: 5004
Number of extensions: 56283
Number of successful extensions: 137
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 137
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 337208592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).