SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0040
         (740 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual      28   1.2  
SPAC12D12.09 |rev7||DNA polymerase zeta Rev7 |Schizosaccharomyce...    27   2.1  
SPAC13A11.01c |rga8|SPAC2F7.18c|GTPase activating protein Rga8 |...    26   4.9  
SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual         26   4.9  
SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|...    25   8.6  

>SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 188

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +3

Query: 99  LFHFFNFKFTSIYFTKFMASC 161
           LF FF+F FTS++F  F   C
Sbjct: 116 LFSFFSFLFTSLHFNFFFRLC 136


>SPAC12D12.09 |rev7||DNA polymerase zeta Rev7 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 213

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -3

Query: 594 HHVTLSVFNKAAYYLEHFIFNTDDI 520
           H V LS+ NK     E ++F+TD I
Sbjct: 78  HQVALSIINKEQREEERYVFSTDSI 102


>SPAC13A11.01c |rga8|SPAC2F7.18c|GTPase activating protein Rga8
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 777

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 11/39 (28%), Positives = 22/39 (56%)
 Frame = -1

Query: 485 VTNMHLLIKIEVSKETFQLTYLNSLNYFVANKIRTTKGV 369
           +T+++ LI +  +KETF +   NSL+  ++       G+
Sbjct: 591 ITHLNRLITLTPNKETFTINLANSLSLCISRPATWNLGI 629


>SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 127

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
 Frame = +1

Query: 211 ISVN*SSKD*VCEKSPNSS---FVSISQWLSKFSRFLFRLNSVCRRFCGL 351
           ++ N S  + + + +PNSS    VS   W+S  ++F + L  +   F GL
Sbjct: 1   MAANISKLEAIIDNTPNSSPDPEVSHKLWVSSLNKFQYTLPLLISNFAGL 50


>SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1372

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 12/30 (40%), Positives = 18/30 (60%)
 Frame = +2

Query: 503 SHLKPVISSVLKMKCSR*YAALLNTESVTW 592
           S+++ +  + LK+K     A  L TESVTW
Sbjct: 179 SYIEKLSCTPLKLKYVESLAVALRTESVTW 208


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,758,884
Number of Sequences: 5004
Number of extensions: 53078
Number of successful extensions: 114
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 114
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 351258950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).