SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC9.04 |Tf2-1||retrotransposable element|Schizosaccharomyces p...    69   8e-13
SPBC9B6.02c |Tf2-9|SPBC9B6.02|retrotransposable element|Schizosa...    69   8e-13
SPAC13D1.01c |Tf2-7||retrotransposable element|Schizosaccharomyc...    69   8e-13
SPAC27E2.08 |Tf2-6||retrotransposable element|Schizosaccharomyce...    69   8e-13
SPAC19D5.09c |Tf2-8|SPAC13D1.02c|retrotransposable element|Schiz...    69   8e-13
SPAC2E1P3.03c |Tf2-3||retrotransposable element|Schizosaccharomy...    69   8e-13
SPAC26A3.13c |Tf2-4||retrotransposable element|Schizosaccharomyc...    69   8e-13
SPCC1020.14 |Tf2-12||retrotransposable element|Schizosaccharomyc...    69   8e-13
SPBC1289.17 |Tf2-11|SPBC8E4.11c|retrotransposable element|Schizo...    69   8e-13
SPAPB15E9.03c |Tf2-5||retrotransposable element|Schizosaccharomy...    69   8e-13
SPAC167.08 |Tf2-2|SPAC1705.01c|retrotransposable element|Schizos...    69   8e-13
SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch...    31   0.20 
SPAC12B10.15c |||ribonuclease H2 complex subunit|Schizosaccharom...    29   1.1  
SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc...    28   1.4  
SPAC15A10.10 |mde6||Muskelin homolog|Schizosaccharomyces pombe|c...    28   1.8  
SPBC32F12.02 |rec14||recombination protein Rec14|Schizosaccharom...    27   3.2  
SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar...    26   5.6  
SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit S...    26   7.5  
SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    26   7.5  
SPBC1E8.03c |||conserved fungal protein|Schizosaccharomyces pomb...    26   7.5  
SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|...    25   9.9  
SPBC3B8.03 |||saccharopine dehydrogenase |Schizosaccharomyces po...    25   9.9  

>SPAC9.04 |Tf2-1||retrotransposable element|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPBC9B6.02c |Tf2-9|SPBC9B6.02|retrotransposable
            element|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAC13D1.01c |Tf2-7||retrotransposable element|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAC27E2.08 |Tf2-6||retrotransposable element|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAC19D5.09c |Tf2-8|SPAC13D1.02c|retrotransposable
            element|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAC2E1P3.03c |Tf2-3||retrotransposable element|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAC26A3.13c |Tf2-4||retrotransposable element|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPCC1020.14 |Tf2-12||retrotransposable element|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPBC1289.17 |Tf2-11|SPBC8E4.11c|retrotransposable
            element|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAPB15E9.03c |Tf2-5||retrotransposable element|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAC167.08 |Tf2-2|SPAC1705.01c|retrotransposable
            element|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1333

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 36/114 (31%), Positives = 60/114 (52%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G PK II D    F+S+  K     +     F+ PY PQT G  ER++ T+++ LR    
Sbjct: 1042 GNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCS 1101

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNTYSD 482
             + +TW  ++     +YN+ IHS T  +P E++  + P    ++  L+L ++SD
Sbjct: 1102 THPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSP----ALSPLELPSFSD 1151


>SPAPB1E7.06c |eme1||Holliday junction resolvase subunit
           Eme1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 738

 Score = 31.1 bits (67), Expect = 0.20
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = +3

Query: 546 NSSNGEKPVVEWILELYASIAVLRYKSHVCWFS 644
           N+SN EK   +WI+     IA+ RYK H   FS
Sbjct: 610 NTSNDEKETAQWIVSFTGDIALSRYK-HFSKFS 641


>SPAC12B10.15c |||ribonuclease H2 complex
           subunit|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 147

 Score = 28.7 bits (61), Expect = 1.1
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = -3

Query: 347 CHIWFDTPAPFFNRYHTQTQ 288
           CHI +D PAP F  +H + Q
Sbjct: 26  CHISYDGPAPVFEYFHDKIQ 45


>SPCP1E11.04c |pal1||membrane associated protein Pal1
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 425

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = -2

Query: 420 SRQKKKDPRPPNSAAADPV 364
           S QKKK+P P +SA+A PV
Sbjct: 58  SIQKKKEPSPASSASASPV 76


>SPAC15A10.10 |mde6||Muskelin homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 716

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = -3

Query: 251 HIQKIQEPFIDKPPKLQNTLLLTARHSTH 165
           ++QK  +P  DK P   N L+L A   TH
Sbjct: 647 YLQKSMQPQFDKSPLFWNALILDAFSGTH 675


>SPBC32F12.02 |rec14||recombination protein
           Rec14|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 302

 Score = 27.1 bits (57), Expect = 3.2
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = -1

Query: 670 KEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLE 551
           KEYL S+I EN H  D+Y   ++     N+ S +G S ++
Sbjct: 3   KEYLVSHIEENAHQADIY---SLNVVAGNLWSASGDSKIK 39


>SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 569

 Score = 26.2 bits (55), Expect = 5.6
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = -1

Query: 748 FGIKHIFASPYHPQTCGALERSHSTL 671
           F I+H   +P HPQ    LER H  L
Sbjct: 277 FLIRHGIITPQHPQYLQTLERIHRPL 302


>SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit Sfc9
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 673

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 10/33 (30%), Positives = 21/33 (63%)
 Frame = -1

Query: 589 SNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNT 491
           SN++  +  + + LL+G+  Y  K++D+  LN+
Sbjct: 491 SNLYLDSSLNAMRLLYGWSVYKQKALDATLLNS 523


>SPBC651.04 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 237

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -1

Query: 592 NSNIHSTTGFSPLELLFGFKPYIPKSID 509
           ++N   T GF P+  +F   PY P S +
Sbjct: 203 DTNELKTNGFEPIRFVFTTTPYSPASFE 230


>SPBC1E8.03c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 477

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 3/78 (3%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
           TC     S+ST  E L   ++       L  + A+LA + ++  T+  SPL +     PY
Sbjct: 154 TCPLSFLSYSTGVERLSKELILKD-LLSLQFQQALLAISPSVIVTSEHSPLVMFQAINPY 212

Query: 526 IPKSI---DSLDLNTYSD 482
           +  +    D++D N   +
Sbjct: 213 LNNNYYTHDTVDTNALEE 230


>SPBC1289.10c |||transcription factor |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 743

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 1/44 (2%)
 Frame = -3

Query: 251 HIQKIQEPFIDKPPKLQNTLLLTARHSTHPTVAK-ERSDFVACP 123
           H QK + P     P++QNT      H THP   +   SDF + P
Sbjct: 274 HQQK-KTPQSGSTPQMQNTTSQPTTHDTHPPKQQGPISDFRSIP 316


>SPBC3B8.03 |||saccharopine dehydrogenase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 450

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +3

Query: 105 TVESQTRAGDEIASFLRYC 161
           T+E   +AG +I SFL YC
Sbjct: 136 TIEEVHKAGGKIKSFLSYC 154


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,073,002
Number of Sequences: 5004
Number of extensions: 63043
Number of successful extensions: 192
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 185
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 192
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 404442380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).