SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB8E5.04c |||phosphatidylglycerol/phosphatidylinositol transf...    29   0.70 
SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase |Schizosacch...    29   0.70 
SPCC1682.15 |mug122||PX/PXA domain protein|Schizosaccharomyces p...    27   3.7  
SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic...    26   4.9  
SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomy...    25   8.6  
SPAC17D4.04 ||SPAC458.01|tRNA |Schizosaccharomyces pombe|chr 1||...    25   8.6  
SPBC4F6.09 |str1||siderophore-iron transporter Str1 |Schizosacch...    25   8.6  

>SPAPB8E5.04c |||phosphatidylglycerol/phosphatidylinositol transfer
           protein |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 188

 Score = 29.1 bits (62), Expect = 0.70
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = +1

Query: 310 HILQLHKNANGMGLILVSAKVLFSHF 387
           H+L    NA+G  L  VSA V FSHF
Sbjct: 154 HVLATAYNADGEQLTCVSASVSFSHF 179


>SPAC19D5.07 |uga1||4-aminobutyrate aminotransferase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 474

 Score = 29.1 bits (62), Expect = 0.70
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
 Frame = +3

Query: 153 RWSAAVPPGLAEFVAPLQRAGLCL--LAHQPHAVGAWTVYMGRASPLTAARPR 305
           +W+   PP +  F    Q AG+    LA +PHA   +  +MG   P  A + R
Sbjct: 319 QWNLPYPPDMVTFSKKFQAAGIFYHDLALRPHAYQHFNTWMG--DPFRAVQSR 369


>SPCC1682.15 |mug122||PX/PXA domain protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 749

 Score = 26.6 bits (56), Expect = 3.7
 Identities = 10/34 (29%), Positives = 22/34 (64%)
 Frame = +2

Query: 635 LCLYRYVYRYVCMSLVCISACMYVSRMYIGMYVC 736
           LC+ R++  Y+  S++ I A + +S ++  +Y+C
Sbjct: 7   LCITRHLLPYIEHSVIPIIALLVLSLIFYILYIC 40


>SPBC19G7.05c |bgs1|cps1, drc1|1,3-beta-glucan synthase catalytic
            subunit Bgs1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1729

 Score = 26.2 bits (55), Expect = 4.9
 Identities = 11/37 (29%), Positives = 20/37 (54%)
 Frame = +2

Query: 593  GLSCLMSLLFSTRKLCLYRYVYRYVCMSLVCISACMY 703
            G   +  LLF +    L  Y+Y ++ ++ +CIS  +Y
Sbjct: 1331 GSRLMYMLLFGSITAWLPHYIYFWITLTALCISPFLY 1367


>SPBC1289.13c |||alpha-1,2-galactosyltransferase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 375

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = +3

Query: 6   PHPSN*NALLLHGRNSYND 62
           PHP N   +LL G N+ ND
Sbjct: 97  PHPENSKIVLLMGSNAQND 115


>SPAC17D4.04 ||SPAC458.01|tRNA |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 654

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = -3

Query: 618 SKDIKQDKPETI*IYNNLANPSLRPEGKHHLNRFYEMCGFFSLVHKD 478
           SK  KQD  ET    ++     ++P+GK+  NRF+E+  F  +   D
Sbjct: 430 SKKRKQDTQETS---SDSKLAEVKPKGKNGGNRFHELDPFVYIKEDD 473


>SPBC4F6.09 |str1||siderophore-iron transporter Str1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 612

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 1/43 (2%)
 Frame = +2

Query: 593 GLSCLMSLLFSTRKLCLYRYVYRYV-CMSLVCISACMYVSRMY 718
           G  C MS LF     C   Y Y ++  +    I+A  Y+S  Y
Sbjct: 369 GACCAMSFLFYITFYCWDNYYYSFLQVVHYTSITAAGYISYTY 411


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,868,274
Number of Sequences: 5004
Number of extensions: 56925
Number of successful extensions: 145
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 144
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 351258950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).