SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC19A8.08 |upf2||nonsense-mediated decay protein Upf2|Schizosa...    29   0.61 
SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c...    28   1.9  
SPAC8F11.03 |msh3|swi4|MutS protein homolog 3|Schizosaccharomyce...    27   4.3  
SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|ch...    26   5.7  
SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha...    26   7.5  
SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual        26   7.5  
SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharo...    25   10.0 
SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pomb...    25   10.0 
SPAC4H3.11c |ppc89|mug127|spindle pole body protein Ppc89|Schizo...    25   10.0 
SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch...    25   10.0 

>SPAC19A8.08 |upf2||nonsense-mediated decay protein
           Upf2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1049

 Score = 29.5 bits (63), Expect = 0.61
 Identities = 13/23 (56%), Positives = 16/23 (69%)
 Frame = +1

Query: 364 R*ISLLCVIHLFDVVVLSKFLSH 432
           R IS LCVIH+ DV  ++ FL H
Sbjct: 747 RFISELCVIHMLDVRAITNFLFH 769


>SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 796

 Score = 27.9 bits (59), Expect = 1.9
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -1

Query: 185 PLMSPPSDGFLLYFFKFILYQSLGLLFIDRGTTKS 81
           P +  P DGFL  +  F  + S+ LL++   +TKS
Sbjct: 187 PGLPQPGDGFLYLYVLFTYFISIFLLYVLFSSTKS 221


>SPAC8F11.03 |msh3|swi4|MutS protein homolog 3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1004

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)
 Frame = -1

Query: 380 SNEIYLLSIYIKMNC--CSLVSLKLENGWTDLANFGLELFVEVQRRFKSLKKYENARN 213
           ++E+  +S Y + N    S+ S +++     L NFGL++ V  Q    +LK   ++RN
Sbjct: 140 ASEVLGISCYFEHNFLNASVPSYRIDYHLERLINFGLKVAVVRQTETAALKSTSSSRN 197


>SPAC1399.02 |||membrane transporter|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 589

 Score = 26.2 bits (55), Expect = 5.7
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -2

Query: 196 ILFFL*CPPRRTDSFCIFLSLF 131
           ++FFL   P+ T SFC+FL  F
Sbjct: 261 LIFFLNLVPKPTVSFCVFLRDF 282


>SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid
           alpha-glucosyltransferase Alg10|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 445

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 6/120 (5%)
 Frame = -1

Query: 389 ITHSNEIYLLSIYIKMNC-CSLVSLKLENGWTDLANFGLELFVEVQRRFKSLKKYENARN 213
           IT    +YL+S+ +     CS VSL+L N W  +   GL   +        +    N R 
Sbjct: 55  ITTPPGLYLVSVALSPFIGCSNVSLRLIN-WL-VGVIGLPWLIN------DIVSLLNNRK 106

Query: 212 YIKTNNFVFPLMSPPSDGFLLYFFKFILYQSLG-----LLFIDRGTTKSDGSASINILIS 48
                 F + L S P     L+FF F+ Y  +G     LL  D    KS  S+S++   S
Sbjct: 107 GDVVTYFAYTLSSLPP----LWFFSFLYYTDIGSTFFVLLAYDFALRKSAFSSSVSCFFS 162


>SPCC1840.04 |||caspase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 425

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 10/23 (43%), Positives = 14/23 (60%)
 Frame = -1

Query: 755 NIKYRYHYCQN*KKHLLSNFNYV 687
           N +Y+Y  CQ  +K LL   NY+
Sbjct: 118 NFQYQYSTCQGKRKALLIGINYL 140


>SPAC15A10.06 |||CPA1 sodium ion/proton
           antiporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 569

 Score = 25.4 bits (53), Expect = 10.0
 Identities = 11/37 (29%), Positives = 21/37 (56%)
 Frame = -1

Query: 209 IKTNNFVFPLMSPPSDGFLLYFFKFILYQSLGLLFID 99
           I T  F    +S  + G L+Y F F+ +++L + F++
Sbjct: 126 ILTFAFAGTFISAVTLGVLVYIFSFLNFENLSMTFVE 162


>SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 952

 Score = 25.4 bits (53), Expect = 10.0
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 5/78 (6%)
 Frame = -1

Query: 227 ENARNYIKTNNFVFP--LMSPPSDGFLLYFFK---FILYQSLGLLFIDRGTTKSDGSASI 63
           E   N+++T+N +FP  L+S  +   L +  K   + L  S  LL    G  +S  +A +
Sbjct: 4   ETHENHLRTHNGIFPVSLLSTQARQLLNFKLKSPSYYLLNSFKLLVKSEGNNQST-TADV 62

Query: 62  NILISKSLTKQASSRDSR 9
            +  S +    +S+R+ +
Sbjct: 63  TLTKSPNAYHASSAREEK 80


>SPAC4H3.11c |ppc89|mug127|spindle pole body protein
           Ppc89|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 783

 Score = 25.4 bits (53), Expect = 10.0
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = -1

Query: 287 NFGLELFVEVQR-RFKSLKKYENAR-NYIKTNNFVFPLMSPP 168
           N  LE    V++ R +++  +E    N  + N  +FPL SPP
Sbjct: 74  NASLETLPSVEKPRGRNMNAFEETSWNRFRKNGSLFPLSSPP 115


>SPBP19A11.04c |mor2|cps12|morphogenesis protein
           Mor2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2196

 Score = 25.4 bits (53), Expect = 10.0
 Identities = 9/23 (39%), Positives = 17/23 (73%)
 Frame = +1

Query: 280 PKLAKSVQPFSSFSETNEQQFIF 348
           P+L +S++P+ S  + + Q+FIF
Sbjct: 920 PQLVRSLKPYISVLKQDHQEFIF 942


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,452,356
Number of Sequences: 5004
Number of extensions: 74026
Number of successful extensions: 187
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 178
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 187
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 408446760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).