SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr 1|...    31   0.23 
SPAC3F10.13 |ucp6||UBA domain protein Ucp6|Schizosaccharomyces p...    30   0.41 
SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosa...    28   1.2  
SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces pombe...    27   2.2  
SPBC29A10.10c |||tRNA-splicing endonuclease positive effector |S...    27   2.9  
SPBC21H7.06c |||inositol metabolism protein Opi10 |Schizosacchar...    27   2.9  
SPCC584.03c |||RanGTP-binding protein |Schizosaccharomyces pombe...    26   6.6  
SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces pomb...    26   6.6  
SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    26   6.6  
SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces pomb...    25   8.8  
SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22...    25   8.8  
SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit ...    25   8.8  
SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subu...    25   8.8  
SPBC29A10.09c |||CAF1 family ribonuclease|Schizosaccharomyces po...    25   8.8  
SPBC336.08 |spc24||spindle pole body protein Spc24|Schizosacchar...    25   8.8  

>SPAC12B10.10 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 419

 Score = 30.7 bits (66), Expect = 0.23
 Identities = 18/66 (27%), Positives = 29/66 (43%)
 Frame = -3

Query: 617 DQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIYKALRNRCNRLC 438
           D  AP+ R   +HK  P   P+++T                   SLAIY+AL  +  + C
Sbjct: 296 DLQAPIPRALKQHKLPPIPVPEVQTTNIGYQTDLPLQNPNDNLVSLAIYEALYEKFLKAC 355

Query: 437 RDAKRL 420
           +D + +
Sbjct: 356 KDLEEV 361


>SPAC3F10.13 |ucp6||UBA domain protein Ucp6|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 612

 Score = 29.9 bits (64), Expect = 0.41
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = -3

Query: 356 GIGKTPVSSVKDTDLCA--LNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVS 183
           G+G T  +S+ D D  A  L+ +FS PP +  DS+  +TL  +++   P   IF   P S
Sbjct: 215 GLGNTN-TSMSDGDCIAAFLSSYFS-PPNAEFDSTFCSTLSSLTNSEKPTY-IFNFKPNS 271

Query: 182 VADVRNSFFS 153
             D+R S  S
Sbjct: 272 TPDLRLSIES 281


>SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 639

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +1

Query: 136 TAVDEMEKKELRTSATETGLNSKIGIRGTDRLEILSNVAVFDESLSDTGGREKCLLRAHK 315
           T+ +  + ++L T   E+G+N KIG  G+ R  ++    VFD +       E+  L  + 
Sbjct: 145 TSTEHKDIEQLETEINESGINYKIGDNGS-RWRMMKLKRVFDMAQDQRRPVEEVALERYG 203

Query: 316 SV 321
           S+
Sbjct: 204 SL 205


>SPBC3D6.10 |apn2||AP-endonuclease Apn2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 523

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 7/62 (11%)
 Frame = -3

Query: 587 IKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPT-------EHSLAIYKALRNRCNRLCRDA 429
           I  K A W+  + + ++            CP        E+  A YKALR R  RL ++ 
Sbjct: 123 IDRKTANWIDSEGRCILLDFQMFILIGVYCPVNSGENRLEYRRAFYKALRERIERLIKEG 182

Query: 428 KR 423
            R
Sbjct: 183 NR 184


>SPBC29A10.10c |||tRNA-splicing endonuclease positive effector
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1944

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = -3

Query: 404  LENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSL 225
            L  RS    +  +       T VS + DTD+C L+K  S      +++ K+  L KI S+
Sbjct: 1130 LNTRSTVDNFVDIYFTSCSPTEVSFLSDTDICLLSKSQSSGD---TNNPKSFQLCKIQSI 1186

Query: 224  S 222
            S
Sbjct: 1187 S 1187


>SPBC21H7.06c |||inositol metabolism protein Opi10
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 200

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%)
 Frame = -3

Query: 188 VSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNF--SFTSSNFP 30
           +SV  + N F    + +    NV +K +  +      ILT+++NF  SF +S  P
Sbjct: 102 ISVEPLTN-FTETPAVSTSASNVIAKPLPPVTSVAQKILTNLYNFLASFATSQLP 155


>SPCC584.03c |||RanGTP-binding protein |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 551

 Score = 25.8 bits (54), Expect = 6.6
 Identities = 11/30 (36%), Positives = 20/30 (66%)
 Frame = -3

Query: 188 VSVADVRNSFFSISSTAVGIDNVCSKMIAL 99
           +S+ DVR  FFS+S   + +D+V + ++ L
Sbjct: 273 ISLNDVRTLFFSLSGKLLRLDDVQTPVLLL 302


>SPAC29E6.09 ||SPAC30.13|sequence orphan|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 339

 Score = 25.8 bits (54), Expect = 6.6
 Identities = 11/44 (25%), Positives = 21/44 (47%)
 Frame = +1

Query: 232 EILSNVAVFDESLSDTGGREKCLLRAHKSVSLTEETGVLPMPTD 363
           E++     F+E LS+     +   R ++     +ET   P+PT+
Sbjct: 7   EVIFKGTEFEEQLSNLTSDSQANKRVYEDYDFKDETSAKPIPTE 50


>SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 860

 Score = 25.8 bits (54), Expect = 6.6
 Identities = 14/38 (36%), Positives = 23/38 (60%)
 Frame = +3

Query: 324 LDRRDRSFANADRFKESPSMSRAAIFK*FVKVKSFSIS 437
           +   D    +AD  KESP+ + ++IFK   K+KS S++
Sbjct: 4   IQENDPIIKSADESKESPAETLSSIFK-RPKIKSSSLN 40


>SPCC1840.03 |sal3|pse1|karyopherin Sal3|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1095

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -3

Query: 164 SFFSISSTAVGIDNVCSKMIALILPTVAPILTD 66
           +  +ISS A G + +  K ++ +L  V P+L D
Sbjct: 391 ALMAISSIAEGAEKLMKKELSRVLDMVLPLLAD 423


>SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase
           Snf22|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1680

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 17/64 (26%), Positives = 25/64 (39%)
 Frame = -3

Query: 413 HKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKI 234
           +   +N + +     L S     TP +S    D+ A   HF  P  S  D+    T  + 
Sbjct: 300 YNGYQNDAASFAHSKLPSSANPNTPFNSTATVDVGAAGSHFPYPQPSNLDAINAKTYFQS 359

Query: 233 SSLS 222
           SS S
Sbjct: 360 SSNS 363


>SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit
           Bdp1 |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 507

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 25/99 (25%), Positives = 42/99 (42%)
 Frame = +1

Query: 43  EVKEKLKISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGLNSKIGIRGT 222
           E KEK +I  S+    G   +  LE +LS PT   +    +L       GLN+      T
Sbjct: 255 EPKEKEEIVGSLEEE-GTDESASLEDSLSHPT---KSILDQLADKMEVDGLNNNSNYSAT 310

Query: 223 DRLEILSNVAVFDESLSDTGGREKCLLRAHKSVSLTEET 339
            R  +++   V DE+  +    E+  + A +   + E +
Sbjct: 311 PRTRVVNGQIVLDETSLEVDRHERDFVPAEEREYVEENS 349


>SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1405

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = +2

Query: 668 YGVQEYTTSRYYLHPVATL 724
           YG   YT SR+Y  P+A L
Sbjct: 937 YGCLGYTKSRFYARPLAVL 955


>SPBC29A10.09c |||CAF1 family ribonuclease|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 427

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = -3

Query: 338 VSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVP 216
           VS    TDL +L    SLPPV  + SS+ + +   S +  P
Sbjct: 330 VSDGIPTDLLSLVSKISLPPVPSNSSSQRSNVSLNSLIECP 370


>SPBC336.08 |spc24||spindle pole body protein
           Spc24|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 198

 Score = 25.4 bits (53), Expect = 8.8
 Identities = 19/83 (22%), Positives = 37/83 (44%)
 Frame = +1

Query: 130 IPTAVDEMEKKELRTSATETGLNSKIGIRGTDRLEILSNVAVFDESLSDTGGREKCLLRA 309
           I   +    +KEL  S T+  + S+     T  +E L   A   +   +   REK   R 
Sbjct: 31  IRAQIQSFREKELEGSQTKFKVLSRKLEISTQAMESLKQTAESSQHAEEILSREKEKFRI 90

Query: 310 HKSVSLTEETGVLPMPTDLRNLQ 378
            K +++TE   ++ + + L+ ++
Sbjct: 91  AKLLNITENE-IMSLESQLQKMK 112


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,024,509
Number of Sequences: 5004
Number of extensions: 61729
Number of successful extensions: 182
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 181
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 359287726
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).