SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce...    36   0.009
SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    28   1.4  
SPBC1E8.05 |||conserved fungal protein|Schizosaccharomyces pombe...    28   1.4  
SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi...    27   2.5  
SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy...    27   3.3  
SPAC1F7.13c |rpl801|rpl8-1, rpl18, rpk5a, rpl2-1, SPAC21E11.02c|...    27   4.4  
SPBC2F12.07c |rpl802|rpl8-2, rpk37, rpk5b|60S ribosomal protein ...    27   4.4  
SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo...    27   4.4  
SPBC839.04 |rpl803|rpl8-3, rpk5-b, rpkD4|60S ribosomal protein L...    27   4.4  
SPBC26H8.02c |sec9||SNAP-25 homologue, t-SNARE component Sec9|Sc...    26   5.8  
SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomy...    26   5.8  
SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces...    26   5.8  
SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|...    26   7.6  
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    26   7.6  

>SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1036

 Score = 35.5 bits (78), Expect = 0.009
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 2/69 (2%)
 Frame = -2

Query: 554 TRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGET--EKTTP 381
           T AT TSS ++S A SNS +++   SSS N T   +    +++ST ++    T    TT 
Sbjct: 204 TSATATSSSLSSTAASNSATSSSLASSSLNSTTSATATSSSISSTVSSSTPLTSSNSTTA 263

Query: 380 ATMSAGNSS 354
           AT ++  SS
Sbjct: 264 ATSASATSS 272



 Score = 31.9 bits (69), Expect = 0.12
 Identities = 20/73 (27%), Positives = 38/73 (52%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S TS    ++ TSS ++S A SNS +++   SSS N T   +    +L+ST  +    + 
Sbjct: 166 STTSATPTSSATSSSLSSTAASNSATSSSLASSSLNSTTSATATSSSLSSTAASNSATSS 225

Query: 392 KTTPATMSAGNSS 354
               +++++  S+
Sbjct: 226 SLASSSLNSTTSA 238



 Score = 29.1 bits (62), Expect = 0.82
 Identities = 12/19 (63%), Positives = 12/19 (63%)
 Frame = -3

Query: 193 GGRPTAVPHREPGVPAGTE 137
           GG PTA P  EP V  GTE
Sbjct: 835 GGNPTAAPTNEPTVTTGTE 853



 Score = 28.3 bits (60), Expect = 1.4
 Identities = 25/73 (34%), Positives = 41/73 (56%)
 Frame = -2

Query: 551 RATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETEKTTPATM 372
           RAT + +  TS A+S+S +++   SSS   +  L++   +  STT+A P  +  T   + 
Sbjct: 58  RATTSYNYNTSSASSSSLTSSSAASSSLTSSSSLAS--SSTNSTTSASPTSSSLT---SS 112

Query: 371 SAGNSSLFGKTTT 333
           SA +SSL   +TT
Sbjct: 113 SATSSSLASSSTT 125



 Score = 27.5 bits (58), Expect = 2.5
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 4/72 (5%)
 Frame = -2

Query: 554 TRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA--*PGETEKTTP 381
           T ++ TSS + S + ++S   +  ++SS+  +  +++  L  +STT++      T  TT 
Sbjct: 110 TSSSATSSSLASSSTTSSSLASSSITSSSLASSSITSSSLASSSTTSSSLASSSTNSTTS 169

Query: 380 A--TMSAGNSSL 351
           A  T SA +SSL
Sbjct: 170 ATPTSSATSSSL 181


>SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 534

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 22/84 (26%), Positives = 47/84 (55%), Gaps = 4/84 (4%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRA----NSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*P 405
           S  S  + +T TSS +++ +    +S+S ST+  LSSS++ +   S+   +   ++++  
Sbjct: 220 SSPSSSSSSTLTSSSLSTSSIPSTSSSSSSTSSSLSSSSSSSTASSSSSSSSIISSSSSS 279

Query: 404 GETEKTTPATMSAGNSSLFGKTTT 333
             +  +T +T+S+ +SS    T+T
Sbjct: 280 SSSPTSTSSTISSSSSSSSSPTST 303



 Score = 27.5 bits (58), Expect = 2.5
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  +  T TSS I+S ++S+S  ++   SSS + +   S+   + +ST ++      
Sbjct: 292 SSSSSSSSPTSTSSTISSSSSSSSSFSSTLSSSSMSSSSSFSSSPTSSSSTISSSSSSPS 351

Query: 392 KT--TPATMSAGNSSLFGKTTT 333
            +  +  T S+ +SS F  T +
Sbjct: 352 SSSFSSTTSSSKSSSSFSSTVS 373


>SPBC1E8.05 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 317

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 18/72 (25%), Positives = 41/72 (56%)
 Frame = -2

Query: 581 PCRSRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PG 402
           P  S +S  +  + +SSK +S + S+S S++   SSS++ +   S+   + +S ++A P 
Sbjct: 154 PSSSSSSSSSSPSSSSSKSSSSSKSSSSSSSSSKSSSSSSSSSKSSSSSSSSSKSSASPS 213

Query: 401 ETEKTTPATMSA 366
            ++ ++  + S+
Sbjct: 214 SSKSSSKFSSSS 225


>SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 374

 Score = 27.5 bits (58), Expect = 2.5
 Identities = 22/73 (30%), Positives = 41/73 (56%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S +S  +    TSS  +S ++S+S S++   SSS++     S+++ T++S+T      T 
Sbjct: 200 SSSSSSSSVPITSSTSSSHSSSSSSSSS---SSSSSRPSSSSSFITTMSSSTFI---STV 253

Query: 392 KTTPATMSAGNSS 354
             TP++ S+  SS
Sbjct: 254 TVTPSSSSSSTSS 266


>SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1201

 Score = 27.1 bits (57), Expect = 3.3
 Identities = 14/45 (31%), Positives = 24/45 (53%)
 Frame = -1

Query: 441  DANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDNNVIFKILNTE 307
            D  + E N+R+  G  KD   + +S   ++  +D N  FK++N E
Sbjct: 929  DIYIDESNERVVKGKSKDNFEYFLSGNTVTRKKD-NACFKMMNFE 972


>SPAC1F7.13c |rpl801|rpl8-1, rpl18, rpk5a, rpl2-1, SPAC21E11.02c|60S
           ribosomal protein L8|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 253

 Score = 26.6 bits (56), Expect = 4.4
 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%)
 Frame = -3

Query: 190 GRPTAVPHRE-PGVPAGTEAGRERGLIRGPPCV 95
           G  T VP +  PG   G  A R  GL+RG   V
Sbjct: 219 GHSTTVPRQSAPGQKVGLIAARRTGLLRGAAAV 251


>SPBC2F12.07c |rpl802|rpl8-2, rpk37, rpk5b|60S ribosomal protein
           L8|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 253

 Score = 26.6 bits (56), Expect = 4.4
 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%)
 Frame = -3

Query: 190 GRPTAVPHRE-PGVPAGTEAGRERGLIRGPPCV 95
           G  T VP +  PG   G  A R  GL+RG   V
Sbjct: 219 GHSTTVPRQSAPGQKVGLIAARRTGLLRGAAAV 251


>SPCC1739.11c |cdc11||SIN component scaffold protein
            Cdc11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1045

 Score = 26.6 bits (56), Expect = 4.4
 Identities = 30/127 (23%), Positives = 42/127 (33%)
 Frame = -3

Query: 766  DGIQHEDGLCRRNVNQQPLVQLGYGRRLHQRGEDCAXXXXXXXXXXXXXXXXXXXXXGHQ 587
            DGIQH DGL + +     + +L +      R E+                          
Sbjct: 706  DGIQHLDGLLKLSACNNRIKELSFTNSNLHRLEELLLGNNEIEEIEEISSLQNLMVLQLD 765

Query: 586  EHHVVRVQAVARGPQGHRRRLLPERIPTHTRPTDN*AHRQTLQSSSQTGC*RWRVQRPPD 407
             + +  ++  A  P  H R L       H    D   H +TL           R  RPPD
Sbjct: 766  NNKLTNLK--ASQPMIHLRILRISNNAIHQLEVDQFPHLRTLYMDLN------RFNRPPD 817

Query: 406  LGRRKRL 386
            + R KRL
Sbjct: 818  IRRLKRL 824


>SPBC839.04 |rpl803|rpl8-3, rpk5-b, rpkD4|60S ribosomal protein
           L8|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 253

 Score = 26.6 bits (56), Expect = 4.4
 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%)
 Frame = -3

Query: 190 GRPTAVPHRE-PGVPAGTEAGRERGLIRGPPCV 95
           G  T VP +  PG   G  A R  GL+RG   V
Sbjct: 219 GHSTTVPRQSAPGQKVGLIAARRTGLLRGAAAV 251


>SPBC26H8.02c |sec9||SNAP-25 homologue, t-SNARE component
           Sec9|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 419

 Score = 26.2 bits (55), Expect = 5.8
 Identities = 11/17 (64%), Positives = 12/17 (70%)
 Frame = -1

Query: 279 NVDSYGDRKTWGSNGSS 229
           N  SYG   T+GSNGSS
Sbjct: 72  NYGSYGASNTYGSNGSS 88


>SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 874

 Score = 26.2 bits (55), Expect = 5.8
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +2

Query: 479 LIICWSSMSWNSLGK*SSTMSLWP 550
           +I C+SS  W  LG  SS  S WP
Sbjct: 779 IIPCFSSECWLLLGHNSSVYSNWP 802


>SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 713

 Score = 26.2 bits (55), Expect = 5.8
 Identities = 26/79 (32%), Positives = 38/79 (48%)
 Frame = -2

Query: 572 SRTSCGTRATRTSSKITSRANSNSYSTNR*LSSSANITIKLSNWMLTLASTTTA*PGETE 393
           S  +C ++A   SS I   A+S S S     + S N T   +N   +L S +T   G+T 
Sbjct: 239 SSKNCLSKALAFSS-IEPPASSASTSPRNTPTPSNNGTSINANVTSSLTSNST---GKTS 294

Query: 392 KTTPATMSAGNSSLFGKTT 336
           KTT   ++A   SL   +T
Sbjct: 295 KTTDLLIAASKKSLPSNST 313


>SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase
           Prp16|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1173

 Score = 25.8 bits (54), Expect = 7.6
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = +1

Query: 340 VFPKRDELPADMVAGVVFSVSPG-QAVVVLANVS 438
           + P   ++PAD+ A +  S  PG + VVV  N++
Sbjct: 735 ILPIYSQMPADLQAKIFDSAEPGVRKVVVATNIA 768


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 25.8 bits (54), Expect = 7.6
 Identities = 14/46 (30%), Positives = 18/46 (39%)
 Frame = +3

Query: 90  SPTQGGPRMSPRSRPASVPAGTPGSR*GTAVGLPPLPGIKTRCVSS 227
           S T   P + P S  ++     P S   T     PLP   T C +S
Sbjct: 297 STTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLPSTSTSCTTS 342


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,146,432
Number of Sequences: 5004
Number of extensions: 61808
Number of successful extensions: 202
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 174
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 199
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 414453330
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).