SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1486.01 |||manganese superoxide dismutase |Schizosaccharomyc...   205   7e-54
SPBC3H7.04 |||mitochondrial ribosomal protein subunit S26|Schizo...    56   5e-09
SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schiz...    43   7e-05
SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyc...    32   0.095
SPBC12C2.04 |||NAD binding dehydrogenase family protein|Schizosa...    30   0.51 
SPAC31A2.16 |gef2||RhoGEF Gef2|Schizosaccharomyces pombe|chr 1||...    30   0.51 
SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr 1||...    27   3.6  
SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|c...    26   6.2  
SPBC342.02 |||glutaminyl-tRNA synthetase |Schizosaccharomyces po...    26   8.2  

>SPAC1486.01 |||manganese superoxide dismutase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 218

 Score =  205 bits (500), Expect = 7e-54
 Identities = 100/206 (48%), Positives = 132/206 (64%), Gaps = 5/206 (2%)
 Frame = +3

Query: 120 IRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAK 299
           + +A     K TLP LPY YNALEP +S  IM LHH KHH TY+NNLN A+EKLA     
Sbjct: 16  VSIARGVHTKATLPPLPYAYNALEPALSETIMKLHHDKHHQTYVNNLNAAQEKLADPNL- 74

Query: 300 GDIDTIINLAPALKFNGGGHINHSIFWHNLSP---NGGKP--SDVLTKAVEKDFGSWDNI 464
            D++  + L  A+KFNGGGHINHS+FW  L+P    GGKP  S  L KA+   +GS ++ 
Sbjct: 75  -DLEGEVALQAAIKFNGGGHINHSLFWKILAPQKEGGGKPVTSGSLHKAITSKWGSLEDF 133

Query: 465 KNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWEHAYYL 644
           + +++ A  ++QGSGW WL  +K    L+I T  NQD +  +    P+ GID WEHAYY 
Sbjct: 134 QKEMNAALASIQGSGWAWLIVDKD-GSLRITTTANQDTIVKSK---PIIGIDAWEHAYYP 189

Query: 645 QYKNVRADYVKAIFDVANWNDISQRY 722
           QY+N +A+Y KAI++V NW +   RY
Sbjct: 190 QYENRKAEYFKAIWNVINWKEAESRY 215


>SPBC3H7.04 |||mitochondrial ribosomal protein subunit
           S26|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 220

 Score = 56.4 bits (130), Expect = 5e-09
 Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 16/138 (11%)
 Frame = +3

Query: 360 INHSIFWHNL-SPNG-GKPSDV----LTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWL 521
           +NH  F+  L SP      +D+    L   ++  FGS+  +K+Q+     +V G GW WL
Sbjct: 76  VNHDFFFSGLISPERPSADADLGAINLKPGIDASFGSFGELKSQMVDVGNSVFGDGWLWL 135

Query: 522 GYNKQMKKLQIATCQNQD---------PLQATTGLVPLFGIDVWEHAYYLQY-KNVRADY 671
            Y+ +     +    N           P   T  +VPL  +++W++AY   Y  N +  Y
Sbjct: 136 VYSPEKSLFSLLCTYNASNAFLWGTGFPKFRTNAIVPLLCVNLWQYAYLDDYGLNGKKMY 195

Query: 672 VKAIFDVANWNDISQRYE 725
           +   +D+ NW  ++ R++
Sbjct: 196 ITKWWDMINWTVVNNRFQ 213


>SPBC16A3.14 |||mitochondrial ribosomal protein subunit
           S26|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 277

 Score = 42.7 bits (96), Expect = 7e-05
 Identities = 53/231 (22%), Positives = 95/231 (41%), Gaps = 36/231 (15%)
 Frame = +3

Query: 150 HTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLN--VAEEKLAQAQAKGDIDTIIN 323
           HT+P L  + N L P+ S E + +   +H    +  LN  V   +L  +     I     
Sbjct: 39  HTVPNLS-QRNLL-PLFSPEALDIAWDQHQRQVVKELNDRVKGTELEDSSVFNIIFQTAA 96

Query: 324 L---APALKFNGGGHINHSIFWHNLSPNGG--------KPSDVLTKAVEKDFGSWDNIKN 470
           L   A   +F    + NH  F   +             + +  + KAV ++FGS +N+ +
Sbjct: 97  LPEHAATFQFASQAYNNHFFFQSLIGKRAADAKKNSKYEANAAINKAVNENFGSKENLLS 156

Query: 471 QLSTASVAVQGSGWGWL---GYNKQ--MKKLQIAT------CQNQDPLQATT-------- 593
           ++   +    G+ W W+    YN+   ++  Q  +       Q+ DP   ++        
Sbjct: 157 KIHELASNSFGACWLWIVIDDYNRLNLLRTFQAGSPYLWTRWQSNDPHLISSVPDYSARP 216

Query: 594 ---GLVPLFGIDVWEHAYYLQYKNV-RADYVKAIFDVANWNDISQRYEKAL 734
                VP+  + +W HAYY  Y  + R+ Y+   FD  +W+ I +R   +L
Sbjct: 217 RKYAHVPILNLCLWNHAYYKDYGLLNRSRYIDTWFDCIDWSVIEERLTNSL 267


>SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 781

 Score = 32.3 bits (70), Expect = 0.095
 Identities = 31/110 (28%), Positives = 47/110 (42%)
 Frame = +3

Query: 141 RQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           RQKHT P  P   +A          S HH  HH+   N L    EK      K + ++  
Sbjct: 97  RQKHTAPATPIPVSA----------SRHHKPHHSGLKNLL----EKAMHPGHKSNANSPT 142

Query: 321 NLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFGSWDNIKN 470
           + +P+  F  G  IN+ I   N S +   P +  +  + K   S+ ++KN
Sbjct: 143 SESPSKGF--GSFINNHILHKNTSSHPSSPVNGKSSDIHKS-QSYQHLKN 189


>SPBC12C2.04 |||NAD binding dehydrogenase family
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 384

 Score = 29.9 bits (64), Expect = 0.51
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%)
 Frame = +3

Query: 231 KHHATYINNLNVAEEKLAQAQAKGDIDTIINLAPAL-KFNGGGHINHSIFWHNLSPNGG 404
           K+HA           K+ QA  K   D  +N+A  + ++N     N+ +FW  +S +GG
Sbjct: 157 KYHAIISIGYMFRYLKIVQAAKKYVADNNLNIACTIARYNSAYEHNNKLFWWYMSKSGG 215


>SPAC31A2.16 |gef2||RhoGEF Gef2|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1101

 Score = 29.9 bits (64), Expect = 0.51
 Identities = 16/56 (28%), Positives = 29/56 (51%)
 Frame = -1

Query: 737 LERFFISLRYIIPVGYIENSFHVVGTNVLVLKIVRVLPYIDSEERDQSSGGLQRIL 570
           + R+ + L  II +       H    +V ++K +  +P +D+EER +   GLQ I+
Sbjct: 388 IPRYSLFLDQIILLTQEGECQHTYVRSVEIIKNIAEMPTVDAEERSRIFAGLQHII 443


>SPAC19D5.04 |ptr1||HECT domain|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 3227

 Score = 27.1 bits (57), Expect = 3.6
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = +3

Query: 564  QNQDPLQATTGLVPLFGIDVW 626
            ++ DPL+AT+  +PLF +  W
Sbjct: 2142 KHTDPLRATSDFIPLFSMQRW 2162


>SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 658

 Score = 26.2 bits (55), Expect = 6.2
 Identities = 8/18 (44%), Positives = 15/18 (83%)
 Frame = +1

Query: 583 RPPLDWSRSSESMYGSTR 636
           +PPL WS SS +++G+++
Sbjct: 101 KPPLTWSPSSANLFGTSK 118


>SPBC342.02 |||glutaminyl-tRNA synthetase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 811

 Score = 25.8 bits (54), Expect = 8.2
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = -1

Query: 329 CKVDNGVDITFSLCLCEFLFSNV 261
           C VD+  +I+ SLC  EF+ S V
Sbjct: 452 CLVDSFENISHSLCTTEFILSRV 474


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,536,257
Number of Sequences: 5004
Number of extensions: 76009
Number of successful extensions: 198
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 185
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 194
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 446488370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).