SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP8B7.24c |atg8||autophagy associated protein Atg8 |Schizosacc...   160   1e-40
SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa...    27   3.1  
SPBC21C3.17c |||conserved fungal protein|Schizosaccharomyces pom...    26   5.3  
SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual        25   9.3  
SPAC3A11.04 |||siepin homolog|Schizosaccharomyces pombe|chr 1|||...    25   9.3  

>SPBP8B7.24c |atg8||autophagy associated protein Atg8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 121

 Score =  160 bits (389), Expect = 1e-40
 Identities = 69/119 (57%), Positives = 92/119 (77%)
 Frame = +2

Query: 44  MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 223
           M+ Q+K++ SFEKRK E ++IR KYPDR+PVI EK  K+ +  +DKKKYLVPSDLTVGQF
Sbjct: 1   MRSQFKDDFSFEKRKTESQRIREKYPDRIPVICEKVDKSDIAAIDKKKYLVPSDLTVGQF 60

Query: 224 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN*F 400
            ++IRKRI L PE A+F F++ ++PPT+A M ++Y+EH  ED FLYI +S EN +G  F
Sbjct: 61  VYVIRKRIKLSPEKAIFIFIDEILPPTAALMSTIYEEHKSEDGFLYITYSGENTFGTVF 119


>SPBC649.05 |cut12|stf1|spindle pole body protein Cut12
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 548

 Score = 26.6 bits (56), Expect = 3.1
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = +2

Query: 35  NINMKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEK 148
           NIN+   YK E    +R  E    ++KYP  +   + K
Sbjct: 154 NININESYKNETKSNQRLGEDVPSKKKYPHSMDAEISK 191


>SPBC21C3.17c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 186

 Score = 25.8 bits (54), Expect = 5.3
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = +1

Query: 388 WKLIPNYSLSNSFTLSDHMVKFNLSLRLKLCIILWYFFYY 507
           WK++ + S + S    D  +   LS+ L  CI++  F ++
Sbjct: 124 WKMVVDVSPAFSVNPIDKKLAIGLSVGLSCCILIVLFLHF 163


>SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 433

 Score = 25.0 bits (52), Expect = 9.3
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 1/21 (4%)
 Frame = -2

Query: 424 NYLKVNNLELISIDIF-VGKC 365
           N  KVN ++LISI++F +G C
Sbjct: 71  NKSKVNEIQLISIEVFIIGIC 91


>SPAC3A11.04 |||siepin homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 236

 Score = 25.0 bits (52), Expect = 9.3
 Identities = 10/15 (66%), Positives = 12/15 (80%)
 Frame = +3

Query: 582 VFTSLFWLSVITAVI 626
           VFTSLFW + IT+ I
Sbjct: 205 VFTSLFWFTGITSTI 219


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,631,304
Number of Sequences: 5004
Number of extensions: 56942
Number of successful extensions: 137
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 137
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 289756512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).