SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC27B12.07 |||conserved fungal protein|Schizosaccharomyces pom...    29   0.97 
SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    28   2.2  
SPAC30D11.13 |hus5|ubc9|SUMO conjugating enzyme Hus5|Schizosacch...    28   2.2  
SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual    27   3.9  
SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||...    26   9.0  
SPAC821.12 |orb6||serine/threonine protein kinase Orb6|Schizosac...    26   9.0  
SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces...    26   9.0  

>SPBC27B12.07 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 290

 Score = 29.1 bits (62), Expect = 0.97
 Identities = 21/73 (28%), Positives = 34/73 (46%)
 Frame = -1

Query: 419 VEVVIHRQT*AFNVGSVCSFHNRVQHLKNQQQKCLFSILLFH*VLRSATYRKLGQAQQQ* 240
           +E ++H Q    N  S   F NR    KN+ Q+    I+  H +L  +    LG+ + + 
Sbjct: 169 LEQLVHEQLNKLNTESKMEFENRKNDTKNEVQQLSARIVELHNLLAVS----LGKLRAEN 224

Query: 239 PGQWFDGVTVAAG 201
             Q +D +  AAG
Sbjct: 225 ERQKWDQIRKAAG 237


>SPAC11G7.01 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 536

 Score = 27.9 bits (59), Expect = 2.2
 Identities = 52/197 (26%), Positives = 84/197 (42%)
 Frame = -2

Query: 718 VPALAGRSRAGSSMSEARVESLNRISCMLGAVSTAGPSSSPRDGLSCCSETRQDSWHPLH 539
           +PA +  + A +S+S + V   +  S +  + +TA  SSS    LS  S T   S     
Sbjct: 22  IPASSSSAAASTSLSSSSVIPSSSSSMLSSSSATAISSSSSSSPLSSSSFTSPAS----- 76

Query: 538 RGQCPRYSTS*VHIV*AQSLTSIVDAGIVLGPRLSSCIVGSKSSSTGRLRPSMSDPFAPF 359
                 + TS V     QS +S       L    S+ +  S S+S     P+ S      
Sbjct: 77  ----SSFITSLVSSSSQQSSSSSAS----LTSSSSATLTSSSSAS-----PTSSSSSHAL 123

Query: 358 ITAYNTLKINSKSVCSPSFSSIKY*GPQRTANSAKHSSSDPASGLTVSRWQLVESWAKHA 179
            ++ ++L + S S    S SS+ +     +++S+ HSSS   SGL+ S   +V S  +  
Sbjct: 124 SSSSSSL-VASSSSSGMSSSSLSHSSSVPSSSSSYHSSSMTTSGLSSSA-SIVSSTYRDG 181

Query: 178 QIHLIIFPASPGYISTI 128
               II   S  Y+S +
Sbjct: 182 P--SIITLVSTSYVSEV 196


>SPAC30D11.13 |hus5|ubc9|SUMO conjugating enzyme
           Hus5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 157

 Score = 27.9 bits (59), Expect = 2.2
 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 1/58 (1%)
 Frame = +2

Query: 143 PRTSWKNN*MDLRMLGPT-FDQLPP*HRQTTGRVTAAVLGRVCGTLRTSVLNGREGWR 313
           P+TSW+     L M  P  +   PP  R T       V     GT+  S+LN  EGW+
Sbjct: 49  PKTSWEGGLYKLTMAFPEEYPTRPPKCRFTPPLFHPNVYPS--GTVCLSILNEEEGWK 104


>SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1236

 Score = 27.1 bits (57), Expect = 3.9
 Identities = 35/135 (25%), Positives = 58/135 (42%), Gaps = 3/135 (2%)
 Frame = -2

Query: 625 VSTAGPSSSPRDGLSCCSETRQDSWHPLHRGQCPRYSTS---*VHIV*AQSLTSIVDAGI 455
           +S++  +SSP+  LS  SE   +    L  G     STS       + +  +TS++ +  
Sbjct: 484 ISSSSSASSPQSTLSTSSEVVSEVSSTLLSGSSAIPSTSSSTPSSSIISSPMTSVLSSSS 543

Query: 454 VLGPRLSSCIVGSKSSSTGRLRPSMSDPFAPFITAYNTLKINSKSVCSPSFSSIKY*GPQ 275
            + P  SS      SSS   +   +S    P  T  +   I S S  SPS +S+      
Sbjct: 544 SI-PTSSS---SDFSSSITTISSGISSSSIP-STFSSVSSILSSSTSSPSSTSLSISSSS 598

Query: 274 RTANSAKHSSSDPAS 230
            ++  +  S+S P+S
Sbjct: 599 TSSTFSSASTSSPSS 613


>SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 322

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 17/55 (30%), Positives = 24/55 (43%)
 Frame = +3

Query: 207 CHRDTVKPLAGSLLLCLAEFAVRCGPQYLMEEKDGEQTLLLLIFKVLYAVMKGAN 371
           C+   +  ++ S L+     A R G   L   KD  + L L   KVL A   G+N
Sbjct: 23  CYTRNIMSVSASSLVPKDFRAFRIGLVQLANTKDKSENLQLARLKVLEAAKNGSN 77


>SPAC821.12 |orb6||serine/threonine protein kinase
           Orb6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 469

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 13/47 (27%), Positives = 22/47 (46%)
 Frame = -2

Query: 274 RTANSAKHSSSDPASGLTVSRWQLVESWAKHAQIHLIIFPASPGYIS 134
           RT N+ K      A  LT+S    + +W K+ ++       +P YI+
Sbjct: 254 RTGNTVKRGQMVDAIWLTMSSKDKMATWKKNRRVMAYSTVGTPDYIA 300


>SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1727

 Score = 25.8 bits (54), Expect = 9.0
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +3

Query: 33   VTCLLQMLMMKNKNIAKVVSDCILVLADYTDRIVE 137
            ++C  Q+L ++NK + + V     V+AD    I E
Sbjct: 1178 ISCQRQLLFLENKKLKRTVESSNRVIADLQRGITE 1212


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,791,191
Number of Sequences: 5004
Number of extensions: 77877
Number of successful extensions: 241
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 240
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 489310570
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).