SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p...    29   0.92 
SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po...    27   3.7  
SPBCPT2R1.03 |||hypothetical protein|Schizosaccharomyces pombe|c...    27   3.7  
SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyce...    27   3.7  
SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual             26   6.5  
SPAC3A12.16c |tim17||TIM23 translocase complex subunit Tim17|Sch...    25   8.6  

>SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 752

 Score = 28.7 bits (61), Expect = 0.92
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = -3

Query: 637 WPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKI 476
           WP    ++  + KT L W  E   L  + + +GG   Q Y  + SA +E  KK+
Sbjct: 195 WPNVGHLFAGKWKTTLPWRVESPELHAVQVHLGGSSLQWYV-IPSAHSESFKKL 247


>SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces
            pombe|chr 3|||Manual
          Length = 2812

 Score = 26.6 bits (56), Expect = 3.7
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = -3

Query: 535  DLQQVYKRLVSAVNEIEKKIPFSHHDR 455
            D+QQ+ + +V+A N  E+K+  +HH R
Sbjct: 2198 DIQQLERSIVNASNMKEEKMLKNHHSR 2224


>SPBCPT2R1.03 |||hypothetical protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 129

 Score = 26.6 bits (56), Expect = 3.7
 Identities = 10/27 (37%), Positives = 15/27 (55%)
 Frame = -3

Query: 268 NKRRMGLTEYDAVKEMYDGIAELIKIE 188
           N R +    YDAVK+ YD   ++  I+
Sbjct: 50  NNRNLAFKAYDAVKQKYDSSIKVFNIQ 76


>SPBC530.04 |mod5||Tea1 anchoring protein Mod5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 522

 Score = 26.6 bits (56), Expect = 3.7
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +3

Query: 213 PSYISLTASYSVSPMRRLLEMSYTPPSASV 302
           P+Y +LT +  VSP R     S   PSASV
Sbjct: 420 PNYANLTPTPQVSPKRPTYSRSSPLPSASV 449


>SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 484

 Score = 25.8 bits (54), Expect = 6.5
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +3

Query: 429 VGQNVRKPSRSWCENGIFFSISLTALTSLLYTCCRSP 539
           +G  +R+ ++SW          +  LTS++Y+CC++P
Sbjct: 376 IGSLIRQLNKSW---------EVVFLTSVIYSCCKTP 403


>SPAC3A12.16c |tim17||TIM23 translocase complex subunit
           Tim17|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 164

 Score = 25.4 bits (53), Expect = 8.6
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +3

Query: 627 PVGQKR-QALAACMKRSPSLNRKWSSMSCCWVSFDMPVRG 743
           P G+KR  A+AA   R+P L   +      + +FD  V+G
Sbjct: 43  PPGEKRISAIAAAKTRAPVLGGNFGVWGGLFSTFDCAVKG 82


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,928,961
Number of Sequences: 5004
Number of extensions: 33543
Number of successful extensions: 97
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 96
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 97
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 353266144
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).