SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC6G10.11c |ubi3||ribosomal ubiquitin fusion protein Ubi3|Schi...   166   3e-42
SPAC589.10c |||ribomal-ubiquitin fusion protein Ubi5|Schizosacch...   166   3e-42
SPAC1805.12c |uep1|ubi2|ribosomal-ubiquitin fusion protein Ubi2|...   106   4e-24
SPAC11G7.04 |ubi1||ribosomal-ubiquitin fusion protein Ubi1|Schiz...   106   4e-24
SPBC337.08c |ubi4||ubiquitin|Schizosaccharomyces pombe|chr 2|||M...   106   4e-24
SPBC12D12.08c |ned8|nedd8, ubl1, SPBC24C6.01c|ubiquitin-like pro...    67   3e-12
SPBC2D10.12 |rhp23||Rad23 homolog Rhp23|Schizosaccharomyces pomb...    39   0.001
SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc...    38   0.002
SPAC6G9.08 |ubp6||ubiquitin C-terminal hydrolase Ubp6|Schizosacc...    36   0.006
SPAC227.15 |||protein phosphatase regulatory subunit Reg1 |Schiz...    28   1.6  
SPBC1718.06 |msp1|mgm1|mitochondrial GTPase Msp1|Schizosaccharom...    27   2.7  
SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyc...    27   4.7  

>SPAC6G10.11c |ubi3||ribosomal ubiquitin fusion protein
           Ubi3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 150

 Score =  166 bits (404), Expect = 3e-42
 Identities = 82/132 (62%), Positives = 96/132 (72%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K Y+TP          +LAVL++YKV+++G + RLRREC    CGA  FMA  +
Sbjct: 77  GKKRKKKTYTTPKKIKHKHKKVELAVLKYYKVEDDGSVKRLRREC--PNCGASTFMANHK 134

Query: 531 DRHYCGKCHSTM 496
           DR YCG+CH T+
Sbjct: 135 DRLYCGRCHLTL 146


>SPAC589.10c |||ribomal-ubiquitin fusion protein
           Ubi5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 150

 Score =  166 bits (404), Expect = 3e-42
 Identities = 82/132 (62%), Positives = 96/132 (72%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRECTGEQCGAGVFMAVME 532
                 K Y+TP          +LAVL++YKV+++G + RLRREC    CGA  FMA  +
Sbjct: 77  GKKRKKKTYTTPKKIKHKHKKVELAVLKYYKVEDDGSVKRLRREC--PNCGASTFMANHK 134

Query: 531 DRHYCGKCHSTM 496
           DR YCG+CH T+
Sbjct: 135 DRLYCGRCHLTL 146


>SPAC1805.12c |uep1|ubi2|ribosomal-ubiquitin fusion protein
           Ubi2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 128

 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>SPAC11G7.04 |ubi1||ribosomal-ubiquitin fusion protein
           Ubi1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 128

 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>SPBC337.08c |ubi4||ubiquitin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 382

 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  106 bits (255), Expect = 4e-24
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVK+KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374


>SPBC12D12.08c |ned8|nedd8, ubl1, SPBC24C6.01c|ubiquitin-like
           protein modifier Ned8|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 78

 Score = 67.3 bits (157), Expect = 3e-12
 Identities = 25/54 (46%), Positives = 41/54 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++P+D +  +K ++++KEGIPP+QQRLI+AGKQ+ D +    Y+++  S LHLV
Sbjct: 17  IDPNDKVSRIKERVEEKEGIPPSQQRLIYAGKQMADDKNAESYHLEGGSVLHLV 70


>SPBC2D10.12 |rhp23||Rad23 homolog Rhp23|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 368

 Score = 38.7 bits (86), Expect = 0.001
 Identities = 17/46 (36%), Positives = 32/46 (69%), Gaps = 1/46 (2%)
 Frame = -2

Query: 882 SDT-IENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           +DT I  +K KIQ ++     +Q+LI++G+ L D +T+ +YNI+++
Sbjct: 20  ADTKISELKEKIQTQQNYEVERQKLIYSGRILADDKTVGEYNIKEQ 65


>SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 354

 Score = 37.9 bits (84), Expect = 0.002
 Identities = 19/54 (35%), Positives = 30/54 (55%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+   ++  +K  I     I   +QRLI+AG+ L+D  +L  Y IQ   ++HLV
Sbjct: 20  VDSESSVLALKEAIAPVADIEKERQRLIYAGRVLKDEESLKTYKIQDGHSIHLV 73


>SPAC6G9.08 |ubp6||ubiquitin C-terminal hydrolase
           Ubp6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 467

 Score = 36.3 bits (80), Expect = 0.006
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           +EP++T   +K ++     +PP +Q++I  G QL+D   L    I+  +TL
Sbjct: 17  IEPNETGSTLKHQLYSLTQVPPERQKVIVKGGQLKDDVLLGSVGIKPNATL 67


>SPAC227.15 |||protein phosphatase regulatory subunit Reg1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 873

 Score = 28.3 bits (60), Expect = 1.6
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +1

Query: 418 NPSYTAVASVPYRLEGTYLFVVVFEDHRAMTLPAV 522
           NP+YT      Y L  TYL    F++HR  +  AV
Sbjct: 144 NPAYTNSHQNSYSLNETYLSYDFFDNHRGASSSAV 178


>SPBC1718.06 |msp1|mgm1|mitochondrial GTPase
           Msp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 903

 Score = 27.5 bits (58), Expect = 2.7
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = +3

Query: 750 PSGYCSPRGYVHLPAAFQQRSTFVDWEGF 836
           PS +  PRG V+ P+  ++R + +   GF
Sbjct: 17  PSSFLKPRGLVYRPSQIRRRVSLLSLSGF 45


>SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 283

 Score = 26.6 bits (56), Expect = 4.7
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%)
 Frame = -2

Query: 636 VLRFY-KVDENGKIHRLRRECTGEQCGAGVFMAVMEDRHYCGKCHSTMVFKDDD 478
           V+R Y ++ +N +     R C  E      F  V++D H   KC + ++    D
Sbjct: 224 VIRCYLRLSDNPRAREALRHCLPEPLRDATFAQVLKDDHNTKKCLAQLLINLSD 277


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,373,540
Number of Sequences: 5004
Number of extensions: 67353
Number of successful extensions: 163
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 153
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 161
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 448490560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).