SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0021
         (602 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAP7G5.02c |gua2||GMP synthase [glutamine-hydrolyzing] |Schizos...    27   2.8  
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    26   3.7  
SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccha...    25   6.4  
SPCC1494.10 ||SPCC70.01|transcription factor |Schizosaccharomyce...    25   6.4  
SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces po...    25   8.5  

>SPAP7G5.02c |gua2||GMP synthase [glutamine-hydrolyzing]
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 539

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 13/50 (26%), Positives = 24/50 (48%)
 Frame = -3

Query: 342 SYGAMIEGLGSGGACIGATRSRRACTASHVPDPITARPVPPDISASNLDI 193
           S+G  +  L +G   IG T++      +HV  PI      P+++ + L +
Sbjct: 150 SHGDRLSALPNGYETIGRTKNSPFAVIAHVTKPIIGLQFHPEVTHTPLGL 199


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = +2

Query: 290  APMQAPPEPSPSIMAP 337
            AP  APP P PS+ AP
Sbjct: 1116 APSGAPPVPKPSVAAP 1131



 Score = 26.2 bits (55), Expect = 3.7
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = +2

Query: 290  APMQAPPEPSPSIMAP 337
            AP  APP P PS+ AP
Sbjct: 1154 APSGAPPVPKPSVAAP 1169


>SPAC23E2.03c |ste7||meiotic suppressor protein
           Ste7|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 569

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = +1

Query: 232 TCSDRIWHMGCRASPSRTGGSNAGPTRTQPFDH 330
           T  D++ +  C  SPSR   SNA    T P  +
Sbjct: 488 TAEDQVHNNHCAVSPSRRSSSNALYLATLPMGY 520


>SPCC1494.10 ||SPCC70.01|transcription factor |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 964

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = +3

Query: 150 SSWKNPQSFNRCKMRCPGLK 209
           +SW  PQSF+   +  PG K
Sbjct: 773 TSWMMPQSFDTSSLNAPGAK 792


>SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 283

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +1

Query: 271 SPSRTGGSNAGPTRTQPFDHGTIR 342
           +PSR+G S AG  RT     G I+
Sbjct: 150 APSRSGASTAGRRRTSATTRGAIQ 173


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,170,744
Number of Sequences: 5004
Number of extensions: 39759
Number of successful extensions: 110
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 98
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 110
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 264253462
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).