SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   466   e-132
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...   260   1e-70
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...   248   5e-67
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...   173   3e-44
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...   119   5e-28
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...   113   4e-26
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...   103   4e-23
SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po...    75   9e-15
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    69   8e-13
SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb...    38   0.002
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    32   0.081
SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce...    32   0.11 
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    31   0.19 
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    30   0.43 
SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo...    29   0.57 
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    28   1.3  
SPCC757.09c |rnc1||RNA-binding protein that suppresses calcineur...    27   3.1  
SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual         27   3.1  
SPBC21D10.12 |hob1||BAR adaptor protein Hob1|Schizosaccharomyces...    27   3.1  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    27   4.0  
SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces p...    26   5.4  
SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|...    26   5.4  
SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosa...    26   5.4  
SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S...    26   7.1  
SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    25   9.4  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  466 bits (1149), Expect = e-132
 Identities = 216/235 (91%), Positives = 227/235 (96%)
 Frame = +1

Query: 82  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 261
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPK+NREKMTQ
Sbjct: 62  RGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREKMTQ 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
           I+FETFN PA YVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI+RLDLA
Sbjct: 122 IIFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSL 786
           GRDLTDYLMKIL ERGY+F+TTAEREIVRDIKEKLCYVALDFEQE+ TAA SSSL
Sbjct: 182 GRDLTDYLMKILMERGYTFSTTAEREIVRDIKEKLCYVALDFEQELQTAAQSSSL 236


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score =  260 bits (638), Expect = 1e-70
 Identities = 117/221 (52%), Positives = 163/221 (73%), Gaps = 1/221 (0%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG EAQ+ RG+L +
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQNLRGLLKI 71

Query: 280 KYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
           + PIE GI+ NW DME+IW + + ++ L   PEEHP+LLTE PL    N+EK+ +  +ET
Sbjct: 72  QRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNKEKIAEYFYET 131

Query: 457 FNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 636
            N PA+  ++Q VL+LYAS RTTGIVL+ GDG++H+VPIY+G+++P AI + ++ GRD+T
Sbjct: 132 LNVPALSFSLQPVLALYASARTTGIVLECGDGLTHSVPIYDGFSIPSAIQQEEIGGRDVT 191

Query: 637 DYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
           DYL   L + G+   ++AE+EIVR+IKEK CYVA DF  E+
Sbjct: 192 DYLQLQLRKSGHELVSSAEKEIVREIKEKCCYVASDFRSEI 232


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score =  248 bits (608), Expect = 5e-67
 Identities = 115/223 (51%), Positives = 161/223 (72%), Gaps = 2/223 (0%)
 Frame = +1

Query: 88  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSK 261
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VGDEA++ 
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAV 61

Query: 262 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 441
           R +L +KYP+E+GI+ ++++M ++W +TF+ +L++ P    +LLTE P+NP ANREKM +
Sbjct: 62  RSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCE 121

Query: 442 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLA 621
            MFE +    +YVAIQAVLSLYA G ++G+V+DSGDGV+H VP+YE   L H + RLD+A
Sbjct: 122 TMFERYGFGGVYVAIQAVLSLYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLVGRLDVA 181

Query: 622 GRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE 750
           GRD T YL+ +L  +GY+F  TA+ E VR++KEKLCYV+ D E
Sbjct: 182 GRDATRYLISLLLRKGYAFNRTADFETVREMKEKLCYVSYDLE 224


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score =  173 bits (420), Expect = 3e-44
 Identities = 102/255 (40%), Positives = 143/255 (56%), Gaps = 34/255 (13%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG---------MGQK-------- 228
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G         M  K        
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIAT-RSAGASSGPAVSSKPSYMASKGSGHLSSK 66

Query: 229 ------DSYVGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 387
                 D ++G++A  K     +L YPI HG + NWD ME+ W  + +  LR  PE+H  
Sbjct: 67  RATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYF 126

Query: 388 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDS 543
           LLTE PLNP  NRE   +IMFE+FN   +Y+A+QAVL+L AS  +        TG V+DS
Sbjct: 127 LLTEPPLNPPENRENTAEIMFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVVDS 186

Query: 544 GDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGY--SFTTTAEREIVRDIK 717
           GDGV+H +P+ EGY +  +I  + LAGRD+T ++  +L +R    S   TAER     IK
Sbjct: 187 GDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDRNEPDSSLKTAER-----IK 241

Query: 718 EKLCYVALDFEQEMA 762
           E+ CYV  D  +E +
Sbjct: 242 EECCYVCPDIVKEFS 256


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score =  119 bits (286), Expect = 5e-28
 Identities = 66/226 (29%), Positives = 120/226 (53%), Gaps = 3/226 (1%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           LV+DNGS   +AG+ G+  P+ VF ++V R R +     + +  + VG++   + G  ++
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYRDRK----LSRTSTLVGNDTLIEVGSRSI 82

Query: 280 -KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 456
            + P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE 
Sbjct: 83  ARSPFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFEL 141

Query: 457 FNTPAMYVAIQAVLSLYASGR--TTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRD 630
           +N P++   I  + S Y + +  ++GIVL+ G+  SH +P+  G  +     R+   G  
Sbjct: 142 YNAPSVAYGIDGLFSFYHNTKPSSSGIVLNLGNAASHVIPVLNGERILSEAKRISWGGSQ 201

Query: 631 LTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATA 768
            + YL+K+   +  SF           +    C+V+ D+  ++A A
Sbjct: 202 SSSYLLKLFQIKYPSFPIKMLPSQAELLMHDHCHVSSDYTHDIAHA 247


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score =  113 bits (271), Expect = 4e-26
 Identities = 64/196 (32%), Positives = 101/196 (51%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           +EV+A+V+D GS   + GF+G+D P+ V PS  G       + G    + Y+    +S  
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFG----EEYI---YKSNP 61

Query: 265 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 444
           G + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + 
Sbjct: 62  G-MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLET 120

Query: 445 MFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAG 624
           MFE+   PA Y+A Q   + +ASG+ T  ++D G   S    IY+G+ L         +G
Sbjct: 121 MFESLRCPATYLAKQETCAAFASGKGTACLVDIGAERSSVSAIYDGFVLQKGYQVQHFSG 180

Query: 625 RDLTDYLMKILTERGY 672
             + D L + L ++ +
Sbjct: 181 NAINDILAQTLRDKNF 196


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score =  103 bits (246), Expect = 4e-23
 Identities = 55/200 (27%), Positives = 103/200 (51%), Gaps = 2/200 (1%)
 Frame = +1

Query: 85  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKR 264
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q   
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQIHA 61

Query: 265 GI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 438
            I  + +K    +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ 
Sbjct: 62  PIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIM 121

Query: 439 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL 618
           +  FE  + PA Y+  QAV   +A+ ++T +++D G   +   P+ +G  +   I +  L
Sbjct: 122 EAAFEQLHVPAFYLTKQAVCVAFANSKSTALIVDIGSDNASVTPVVDGLIIRKGIFKQSL 181

Query: 619 AGRDLTDYLMKILTERGYSF 678
           AG  L   + ++       F
Sbjct: 182 AGDFLNANIEQLFNTMNIEF 201


>SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 401

 Score = 75.4 bits (177), Expect = 9e-15
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 18/238 (7%)
 Frame = +1

Query: 100 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 279
           +V+DNG+   KAGFAG        P+ + R +        G +  ++G+E  +     TL
Sbjct: 8   IVLDNGAYHIKAGFAGGKV--VEIPNCLTRSKD-------GNR-LFLGNELANCNDFTTL 57

Query: 280 KYPIEH--GIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKANREKMTQIM 447
           ++   H  G + +W     +W     N   + P   ++ +LLT+      +      Q++
Sbjct: 58  QFRRAHEKGYLVHWSTETAVWDLVMRNVGVMEPSMADYSLLLTQPVFTMPSIEHNTIQLV 117

Query: 448 FETFNTPAMYVAIQAVLSLYASGRTT--------------GIVLDSGDGVSHTVPIYEGY 585
           FE F   A      A L  +  G  T               +V+DSG   +H +P+ +  
Sbjct: 118 FEEFQFDAYLPCTPAELIPWDHGSFTMNQEDAYTGQHGECVLVIDSGYSFTHIIPVIDFS 177

Query: 586 ALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM 759
               A+ R+D+ G+ LT+YL ++++ R Y+     E  IV +IKE +CYV+ +F+++M
Sbjct: 178 VQEQAVKRVDVGGKLLTNYLKEVISYRKYNM--MEETYIVNEIKESVCYVSQNFKEDM 233


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 68.9 bits (161), Expect = 8e-13
 Identities = 44/149 (29%), Positives = 70/149 (46%), Gaps = 4/149 (2%)
 Frame = +1

Query: 286 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 453
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 454 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 633
               P   +A + ++ LYA G   G+V+D G   +   PI +G  +  A  +L L GR +
Sbjct: 172 ECQVPGFTIAYEPLMGLYAIGILHGLVIDIGYEKTDITPILDGQIIFTATQQLPLGGRYM 231

Query: 634 TDYLMKILTERGYSFTTTAEREIVRDIKE 720
           T +L  +L E   +  ++ +     DI E
Sbjct: 232 TQHLQNLLRESLPTLKSSGQYVSKEDITE 260


>SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 28/146 (19%), Positives = 67/146 (45%), Gaps = 12/146 (8%)
 Frame = +1

Query: 277 LKYPIEHGIVTNWD---------DMEKIWHHTFYNELRVAPEE---HPVLLTEAPLNPKA 420
           L YPI+ G+    D         D+ +I+ ++  + L++   +   + V+     L  + 
Sbjct: 198 LFYPIKSGVFNESDYASSQQLLADIYEIFKYSITSLLQIPVSQLSQYSVIFIVPDLYDRV 257

Query: 421 NREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHA 600
             EK+  I+F   +     +  +++ + + +G +   V+D G   +    + EG  +P++
Sbjct: 258 YVEKILDILFFDLHFGKAAIVQESLCTSFGAGMSAACVVDMGAQKTSISCVEEGVVVPNS 317

Query: 601 ILRLDLAGRDLTDYLMKILTERGYSF 678
            ++++  G D+T   MK+L    + +
Sbjct: 318 RIKINYGGDDITLLFMKLLMRSHFPY 343


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 32.3 bits (70), Expect = 0.081
 Identities = 17/45 (37%), Positives = 21/45 (46%)
 Frame = +2

Query: 470  PCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
            P T+P  P    T PV P  S   P+   P P PS++    P PS
Sbjct: 1037 PSTAPPVPIPTSTPPV-PKSSSGAPSAPPPVPAPSSEIPSIPAPS 1080



 Score = 28.3 bits (60), Expect = 1.3
 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 5/51 (9%)
 Frame = +2

Query: 467  PPCTSPSKPCSRCTRPVVPPVSCWTP-----ATVSPTPCPSTKDTHSPTPS 604
            PP  +P  P      P VPP S   P     A + P P P+ K    P PS
Sbjct: 1193 PPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPS 1243



 Score = 26.6 bits (56), Expect = 4.0
 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%)
 Frame = +2

Query: 467  PPCTSPSKPCSRCTRP--VVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
            PP   PS       +P   VPPV    P+   P P PS      P PS
Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPA--PSGAPPVPKPSVAAPPVPVPS 1137



 Score = 25.8 bits (54), Expect = 7.1
 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 2/48 (4%)
 Frame = +2

Query: 467  PPCTSPSKPCSRCTRPV--VPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
            PP  +PS       +P   VPPV    P+   P P PS      P PS
Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVP--PPSEAPPVPKPSVGVPPVPPPS 1214


>SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1666

 Score = 31.9 bits (69), Expect = 0.11
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = +1

Query: 346  FYNELRVAPEEHPVLLTE--APLNPKANREKMTQIMFETFNTPAM---YVAIQ 489
            +Y  L    E+HP+LLT+  A L P+ +  ++ +I  ++ NTP +    VAIQ
Sbjct: 1399 YYRALNFYLEQHPMLLTDLLAALTPRIDHPRVIRIFEKSENTPLILNFMVAIQ 1451


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1517

 Score = 31.1 bits (67), Expect = 0.19
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +1

Query: 145 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 288
           G+  PRA F  ++  P H G+++ M  KD   G+E  S +G  + + P
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEEFMSPKGFKSPRTP 547


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 29.9 bits (64), Expect = 0.43
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 1/54 (1%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTPS 604
           C+  ++ PP T  S   S    P VPP S   T   + PT   ST    SP P+
Sbjct: 172 CTTSTSIPP-TGGSSSLSTPITPTVPPTSTSSTSIPIPPTSTSSTDTNSSPLPT 224



 Score = 29.9 bits (64), Expect = 0.43
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
 Frame = -1

Query: 242 PT*ESFCPI-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 81
           PT  S  P+ PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 401 PTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455



 Score = 28.7 bits (61), Expect = 1.0
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 1/54 (1%)
 Frame = +2

Query: 446 CSKHSTRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTPS 604
           C+  ++ PP T  S   S    P VPP S   T   + PT   ST    +P P+
Sbjct: 115 CTTSTSIPP-TGGSSSLSTPITPTVPPTSTSSTSIPIPPTSTSSTDTNSNPLPT 167



 Score = 26.2 bits (55), Expect = 5.4
 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%)
 Frame = +2

Query: 458 STRPPCTSPSKPCSRCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSPTPS 604
           ST  P T  S   S    P VPP S   T   + PT   ST    SP P+
Sbjct: 232 STSIP-TGGSSSLSTPITPTVPPTSTSSTSIPIPPTSTSSTDTNSSPLPT 280


>SPCC18.03 |||shuttle craft like transcriptional
           regulator|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1077

 Score = 29.5 bits (63), Expect = 0.57
 Identities = 13/35 (37%), Positives = 16/35 (45%)
 Frame = +2

Query: 491 PCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSP 595
           PC+     + PPV+C TP    P  C   K  H P
Sbjct: 621 PCTCGRTRLYPPVACGTPIPDCPYLCVLPKSCHHP 655


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 28.3 bits (60), Expect = 1.3
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -2

Query: 253 VPHLLHKSPSVPYRPSRPDGGAFPRSRGTR 164
           +  L+ K+PS PY  SRP   A   S  TR
Sbjct: 306 IDQLISKAPSYPYSSSRPSASASLASSPTR 335


>SPCC757.09c |rnc1||RNA-binding protein that suppresses calcineurin
           deletion Rnc1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 398

 Score = 27.1 bits (57), Expect = 3.1
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = +2

Query: 491 PCSRCTRPVVPPVSCWTPATVSPTPCPST 577
           P SR T+P+    S  +P  VSP   PST
Sbjct: 262 PVSRLTQPLPSLASTASPQQVSPPAAPST 290


>SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 127

 Score = 27.1 bits (57), Expect = 3.1
 Identities = 23/60 (38%), Positives = 28/60 (46%)
 Frame = -3

Query: 282 FEGQDTSFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYY 103
           F G   +F  CLI++IR  +SH            D  EHG   II C T L   G I+YY
Sbjct: 47  FAGLGIAFIYCLIAFIRE-MSHPSSR-------KDTMEHGL-PIILCST-LMLVGNILYY 96


>SPBC21D10.12 |hob1||BAR adaptor protein Hob1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 466

 Score = 27.1 bits (57), Expect = 3.1
 Identities = 12/36 (33%), Positives = 15/36 (41%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPS 574
           PP   P    +  T PV  PV+    A   P P P+
Sbjct: 367 PPPVMPQPAAAAVTTPVAAPVAAAAAAVPVPPPAPA 402


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.6 bits (56), Expect = 4.0
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -1

Query: 245 SPT*ESFC--PIPTITP*WRGLPTIEGNTARGASSPAKPAL 129
           S T +SF   P+PT  P    LPT   NT +    P+ PAL
Sbjct: 64  SNTPKSFAAPPVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 226

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +1

Query: 388 LLTEAPLNPKANREKMTQIMFETFN 462
           +L  APL+ +   +KM +++FET+N
Sbjct: 181 VLETAPLHAEEVSKKMKELLFETYN 205


>SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 194

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 18/51 (35%), Positives = 21/51 (41%)
 Frame = +3

Query: 507 RVRSYHRYRAGLRRRCLPHRAHLRRIRTPPRHPASGLSRSRPHRLPHEDPH 659
           R RS HR+  G  RR  P+R HL R     RH  +     R  R      H
Sbjct: 142 RTRSNHRH--GSHRRHEPYRTHLSRHH---RHSTTNYHSKRDDRYERRREH 187


>SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1628

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 20/82 (24%), Positives = 38/82 (46%)
 Frame = +3

Query: 402  SPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRSYHRYRAGLRRRCLPHRAHLRR 581
            +PQ +    E++ D++R++  +RH RR P +A  +  R  H  +   R R      ++ R
Sbjct: 1428 TPQSRSFTNENN-DNLRSV--SRHTRREPQQAQNLNARREHESQKSDRWR---QNGNVNR 1481

Query: 582  IRTPPRHPASGLSRSRPHRLPH 647
                  + ++ +SR R     H
Sbjct: 1482 NPRVSNNNSTNVSRERSSEANH 1503


>SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase
           Tor2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2337

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = -3

Query: 282 FEGQDTSFALCLISYIRVLLSHTDHHA 202
           +EG+DT+      +Y+R++L  TD  A
Sbjct: 74  YEGEDTTRITRFANYLRIILPGTDQKA 100


>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 25.4 bits (53), Expect = 9.4
 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 3/50 (6%)
 Frame = +2

Query: 485  SKPCSRCTRPVVPPVSCWT---PATVSPTPCPSTKDTHSPTPSCVWT*PV 625
            S+  S  T P  PP +  T   PA  SP P    +  H PT S     PV
Sbjct: 899  SRTSSVSTLPPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPV 948


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,429,443
Number of Sequences: 5004
Number of extensions: 77377
Number of successful extensions: 296
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 241
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 280
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 383374054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).