SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22G7.01c ||SPAPJ696.03c|aminopeptidase |Schizosaccharomyces ...    29   0.62 
SPCC4F11.03c |||sequence orphan|Schizosaccharomyces pombe|chr 3|...    27   2.5  
SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|...    27   3.3  
SPCC965.14c |||cytosine deaminase |Schizosaccharomyces pombe|chr...    27   4.4  
SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomy...    26   5.8  
SPAC22F8.07c |rtf1||replication termination factor Rtf1|Schizosa...    26   7.6  
SPAC22E12.16c |pik1||phosphatidylinositol kinase Pik1|Schizosacc...    26   7.6  
SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po...    26   7.6  

>SPAC22G7.01c ||SPAPJ696.03c|aminopeptidase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 598

 Score = 29.5 bits (63), Expect = 0.62
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 5/43 (11%)
 Frame = -1

Query: 645 DGFVEVLPYDAV-----HKRLERVGVLAVDVHDWAAAALFSQT 532
           DGFV++LPYD V     +  L R+G+ +     W  A  F +T
Sbjct: 247 DGFVKILPYDRVFSDAKNSNLTRIGISSKT--SWCIATSFGET 287


>SPCC4F11.03c |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 335

 Score = 27.5 bits (58), Expect = 2.5
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +1

Query: 379 YLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYV 507
           YL+ +L    PN  Y    Q A +  +DY   E IRI+E   V
Sbjct: 32  YLLRSLLANVPNALYHSQLQAACQKFQDYCDLEEIRIIEAKRV 74


>SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 512

 Score = 27.1 bits (57), Expect = 3.3
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -2

Query: 626 SHMTRFTNDSNELVYSLWMFMIGQ 555
           SH  +F ND  E  Y  W F+  Q
Sbjct: 203 SHTYKFVNDKGEFYYCKWHFITNQ 226


>SPCC965.14c |||cytosine deaminase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 162

 Score = 26.6 bits (56), Expect = 4.4
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 508 GMNNEYRISLAKKGGGCPIMNIHS 579
           G++NE  I L +K G CP + I+S
Sbjct: 105 GLSNENLIKLTQKSGECPPLYINS 128


>SPAC4G8.09 |||mitochondrial leucine-tRNA ligase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 874

 Score = 26.2 bits (55), Expect = 5.8
 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 4/43 (9%)
 Frame = +1

Query: 265 DTMKLIVNWSGK-EFLRETW---TRFVEDSFPIVNDQEVMDVY 381
           D ++ +  W  K + ++  W   T   E SFP++ND+E + V+
Sbjct: 230 DDLETLPKWPDKVKKMQRNWIGRTTGFEISFPLLNDKETLTVF 272


>SPAC22F8.07c |rtf1||replication termination factor
           Rtf1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 466

 Score = 25.8 bits (54), Expect = 7.6
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +1

Query: 214 GKNQKLTLFKEIRSVKPDTMKLIVNWSGKEFLRETWT 324
           G N  +TL KEI   K        NWS ++FL+  W+
Sbjct: 186 GANDIITLEKEIAMFKKKK-----NWSDEQFLQYVWS 217


>SPAC22E12.16c |pik1||phosphatidylinositol kinase
           Pik1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 851

 Score = 25.8 bits (54), Expect = 7.6
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 8/70 (11%)
 Frame = +1

Query: 109 KNAKRKKHLVEHEQEEKQW-DLLD-----NYMVAEDPFLGPGKNQ--KLTLFKEIRSVKP 264
           KN  + + +V H+ + K+W DL D     N   + D  +   +++   L++   I+ + P
Sbjct: 354 KNKAKVQKIVSHKNQRKRWFDLTDVDPYTNLQDSTDNDISESESEGGDLSMSPLIKGLVP 413

Query: 265 DTMKLIVNWS 294
           DT+ L  ++S
Sbjct: 414 DTLSLSKSFS 423


>SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 622

 Score = 25.8 bits (54), Expect = 7.6
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +1

Query: 16  PINMPNYSYTPTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEK 159
           P+ M + S  P+     VY+    + L C   NAK  + LV+ + EE+
Sbjct: 387 PVQMVHRSALPSQDHWKVYELITRRFLACCSDNAKGAETLVQVKMEEE 434


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,569,707
Number of Sequences: 5004
Number of extensions: 78070
Number of successful extensions: 218
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 204
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 218
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 412451140
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).