SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0018
         (929 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos...    27   2.8  
SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1...    27   2.8  
SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor Raf1|S...    27   3.8  
SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces...    26   6.6  

>SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 640

 Score = 27.5 bits (58), Expect = 2.8
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = +1

Query: 124 IKPLFRLFLYKTGIIRFLVRVEIKRNRTDLERVDRLSIVQLYVLVDWFSML 276
           + P   + L+++GI+R L  ++ + +RTD+     L  V LY+  D  ++L
Sbjct: 546 VSPDIAMRLFQSGILRKLRDLQEQYSRTDVALAMTLRDVTLYIGKDHITLL 596


>SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1841

 Score = 27.5 bits (58), Expect = 2.8
 Identities = 11/27 (40%), Positives = 17/27 (62%)
 Frame = +1

Query: 751  STARTGSNHAVRLEGRRCSKAYIMGKN 831
            S A+ G N+  R  GR+ S +Y++ KN
Sbjct: 1505 SKAKKGYNYEKRRSGRQVSDSYVLNKN 1531


>SPCC613.12c |raf1|dos1, cmc1, clr8|Rik1-associated factor
           Raf1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 638

 Score = 27.1 bits (57), Expect = 3.8
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = +1

Query: 718 NVRMYSVCTQFSTARTGSNHA 780
           + RMY VC  F+T +   NHA
Sbjct: 474 DTRMYKVCLNFTTTQKDINHA 494


>SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 567

 Score = 26.2 bits (55), Expect = 6.6
 Identities = 21/81 (25%), Positives = 35/81 (43%)
 Frame = +1

Query: 430 TLTVQKVSLKL*TYRMFCSGDLGPSSSNLIPLGQIKQEPDLHTPSRRRAKLKPDLKLKVS 609
           TL+  KVS  L    M  + D G S++N         +P   + + ++    P  K+K  
Sbjct: 15  TLSESKVSENL----MSINSDSGTSNANTPSSVTSNSKPVASSTAAKKDPNAPPQKVKQY 70

Query: 610 VCKVLSACSYFHTQITRHVRS 672
           VC+  +        + RH+RS
Sbjct: 71  VCETCTRAFARLEHLKRHIRS 91


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,948,477
Number of Sequences: 5004
Number of extensions: 81433
Number of successful extensions: 162
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 155
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 162
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 471335896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).