SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0017
         (851 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB2B4.04c ||pmc1, pmc1|P-type ATPase, calcium transporting Pm...    28   1.9  
SPAC5D6.12 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||...    27   2.6  
SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce...    27   3.4  
SPBC1271.05c |||zinc finger protein zf-AN1 type|Schizosaccharomy...    27   3.4  
SPCC290.04 |ams2|SPCC4F11.01|cell cycle regulated GATA-type tran...    27   4.5  

>SPAPB2B4.04c ||pmc1, pmc1|P-type ATPase, calcium transporting Pmc1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1292

 Score = 27.9 bits (59), Expect = 1.9
 Identities = 17/68 (25%), Positives = 27/68 (39%), Gaps = 2/68 (2%)
 Frame = +3

Query: 216 PTS*GYAGIASQGYQLR*EKKKNNDDQRSRSPRYGDPIRPPDTPRSQNQPAGSERDTPP- 392
           P+S  + G+ S  Y  R    ++     SR P     + P  +  S  +     + TPP 
Sbjct: 24  PSSSQFLGVPSSNYNQRENSSRSGSSTISREPSSSGTMYPMASRDSMKESYDKNKGTPPD 83

Query: 393 -TGLLLHS 413
            T  + HS
Sbjct: 84  YTSYVSHS 91


>SPAC5D6.12 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 314

 Score = 27.5 bits (58), Expect = 2.6
 Identities = 12/28 (42%), Positives = 14/28 (50%)
 Frame = +3

Query: 291 DQRSRSPRYGDPIRPPDTPRSQNQPAGS 374
           DQ   S    DP  PPD+PR Q    G+
Sbjct: 108 DQVENSSNIYDPSSPPDSPRKQQTHLGT 135


>SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1261

 Score = 27.1 bits (57), Expect = 3.4
 Identities = 14/54 (25%), Positives = 27/54 (50%)
 Frame = +3

Query: 126  RFRSGGRFCEARLLLGFVLATSSGLSPLNSPTS*GYAGIASQGYQLR*EKKKNN 287
            +F+S   FC+   +LG++   S+    +N+ T  G    A+    +  E K++N
Sbjct: 868  QFKSSNLFCDNMKMLGYIPRASTFAHLINNSTRRGDTDDATTALNIFEETKRHN 921


>SPBC1271.05c |||zinc finger protein zf-AN1 type|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 215

 Score = 27.1 bits (57), Expect = 3.4
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +3

Query: 30  SSNPSLATKGSTSKLTLRHSPLSFSPDLLSGSRFRSGGRFCEARLLL 170
           SS+ +L T+ +TS+    H   +     L+G+     GRFC A  L+
Sbjct: 134 SSDKALLTRPATSRRRCCHPTCTRITLRLAGNCLHCNGRFCAAHRLM 180


>SPCC290.04 |ams2|SPCC4F11.01|cell cycle regulated GATA-type
           transcription factor Ams2|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 697

 Score = 26.6 bits (56), Expect = 4.5
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%)
 Frame = -1

Query: 179 DEP*QEP-CFAESTTGSETRPTEKIRRETQWAVPE 78
           D P  +P C A STT +    T+K RRE+    PE
Sbjct: 255 DHPATDPVCSASSTTVNSAVSTKKRRRESSTISPE 289


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,364,535
Number of Sequences: 5004
Number of extensions: 68396
Number of successful extensions: 150
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 150
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 422462090
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).