SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|ch...    33   0.065
SPAC4G9.11c |cmb1||cytosine-mismatch binding protein 1|Schizosac...    30   0.46 
SPAC16C9.05 |||PHD finger containing protein|Schizosaccharomyces...    29   0.60 
SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2...    28   1.8  
SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|c...    27   2.4  
SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces ...    27   4.3  
SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyce...    26   5.6  
SPBC215.01 ||SPBC3B9.20|GTPase activating protein|Schizosaccharo...    26   7.4  
SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces...    25   9.8  

>SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 244

 Score = 32.7 bits (71), Expect = 0.065
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%)
 Frame = +1

Query: 478 KENIEAHAEEALDAPPRPDIEEEEGFVPVISHGR-----RPGKNRRDRERK 615
           ++  E H E   +  PR  +E E  + P + HGR     R  + RRDR+ +
Sbjct: 63  RDRYERHRESVREESPRRPVEHERNWQPELKHGRERFRERDYEGRRDRKER 113


>SPAC4G9.11c |cmb1||cytosine-mismatch binding protein
           1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 223

 Score = 29.9 bits (64), Expect = 0.46
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +2

Query: 566 SLMDGVLVKTGGTGNGKHPRELIKHHNSMLTLSPQRSNSNKLQ 694
           ++ + +LV+T G GNG    E+I+     LT    +   NKLQ
Sbjct: 56  TIWNQMLVETKGAGNGPERFEMIRQKYKALTADEIQKYKNKLQ 98


>SPAC16C9.05 |||PHD finger containing protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 404

 Score = 29.5 bits (63), Expect = 0.60
 Identities = 17/52 (32%), Positives = 27/52 (51%)
 Frame = -1

Query: 328 HASTGHVGG*PNNFDANLDTFSVLCVQRVSQNHKQNTKARVYELI*SKLVAH 173
           H+ST HV   P + D  +D  S +  Q+ S ++K   KA + +   S L +H
Sbjct: 44  HSSTDHVNVLPISQDKEMDISSPVKKQKASYSNKSPNKAPIQKSRGSSLKSH 95


>SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1217

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = -3

Query: 449  TDA*EGPAPSADTRAAITPPLSLI*VRAR-APRREAITSAHPCFNRP 312
            T A  GP P    + A T P+S+   +++ AP    +++A    NRP
Sbjct: 980  TAAARGPRPVVQNKPAATKPVSMPAAKSKPAPMANPVSTAQQTQNRP 1026


>SPAP14E8.02 |||transcription factor |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 566

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 5/63 (7%)
 Frame = +1

Query: 451 LNFKGGESNKENIEAHAEEAL----DAPPRPDIEEEEGFVPVISHGRR-PGKNRRDRERK 615
           LN K  E N+E +    +EAL     +PP  D + ++  + + ++    P  N R  E  
Sbjct: 185 LNAKNYEENREPMSPSPQEALPLMPSSPPSQDYQNDQNHLILYTNSESIPKLNLRSNELV 244

Query: 616 APP 624
            PP
Sbjct: 245 YPP 247


>SPAC222.09 |seb1||RNA-binding protein Seb1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
 Frame = +1

Query: 388 SGGVMAARVSAEGAGP---SYASVLNFKGGESNKENIEAHAEEALDAPPRPDI 537
           +GG + ++ +A  + P     AS+L      + K  + + AEE++  PP+P +
Sbjct: 174 NGGSVGSQAAAPTSRPVENDAASILEALAAFAQKAPVPSAAEESVSTPPQPAV 226


>SPBC4C3.06 |||actin cytoskeletal protein Syp1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 818

 Score = 26.2 bits (55), Expect = 5.6
 Identities = 22/91 (24%), Positives = 37/91 (40%)
 Frame = +1

Query: 346 ASRRGARARTYIRDSGGVMAARVSAEGAGPSYASVLNFKGGESNKENIEAHAEEALDAPP 525
           A+ R    R+   ++   +   V AE   P  +S    K    NK N   H+E + + P 
Sbjct: 376 ATIRANNVRSSFLEAPLPVQPNVQAETVTPKISS----KASPFNKPN-SVHSEASRNTPS 430

Query: 526 RPDIEEEEGFVPVISHGRRPGKNRRDRERKA 618
             D E      P++ HG   G N  + + ++
Sbjct: 431 SIDRENASHSNPIMMHGNDFGGNFNNMQSRS 461


>SPBC215.01 ||SPBC3B9.20|GTPase activating
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 834

 Score = 25.8 bits (54), Expect = 7.4
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = -1

Query: 247 RVSQNHKQNTKARVYELI*SKLVAHHTDPGRTVFTSKKFTS 125
           R+S    + T A   +L+  +LV+H  D  R+   SK+F S
Sbjct: 113 RISLQVSETTAAHFCQLLREELVSHKADMQRSSEFSKQFFS 153


>SPBC24C6.10c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 374

 Score = 25.4 bits (53), Expect = 9.8
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = -2

Query: 144 HQKNSLPSADSRFFSILNKAHEWYLSIESAV--CGEK 40
           ++KN L    S+F S +NK  E YL  E  +  C EK
Sbjct: 28  YEKNELEIGVSKFLSFINKYGEPYLITEFQLQRCMEK 64


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,140,931
Number of Sequences: 5004
Number of extensions: 61319
Number of successful extensions: 193
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 188
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 192
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 402440190
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).