SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0009
         (585 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC285.13c |||nucleoporin Nup60 |Schizosaccharomyces pombe|chr ...    27   1.5  
SPAC11D3.03c |||meiotic chromosome segregation protein|Schizosac...    27   2.7  
SPBC354.01 |gtp1|SPBC649.06|GTP binding protein Gtp1|Schizosacch...    25   6.2  
SPCC4F11.04c |||mannosyltransferase complex subunit |Schizosacch...    25   6.2  
SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|...    25   8.1  
SPBC354.05c |sre2||membrane-tethered transcription factor |Schiz...    25   8.1  

>SPCC285.13c |||nucleoporin Nup60 |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 736

 Score = 27.5 bits (58), Expect = 1.5
 Identities = 24/68 (35%), Positives = 32/68 (47%)
 Frame = +3

Query: 297 RHCTTWVPPISLSWSHWEWGSPGLRPRPYDRRSTGSSLRDA*STFPQFRTPTPLRGSTTR 476
           RH TT   PISLS S     +P L  +P   R   +++    ++F    T +PL  STT 
Sbjct: 261 RHSTT---PISLSNSI----APSLSFQPKKARYESANVSFNDTSFTNVPTSSPLHQSTTA 313

Query: 477 QSALSTPS 500
                TPS
Sbjct: 314 NHPEKTPS 321


>SPAC11D3.03c |||meiotic chromosome segregation
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 302

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 2/29 (6%)
 Frame = +2

Query: 77  RPAL-LVGD-LNAKHVAWGSRLNSAVGRR 157
           RP + ++GD L A+H  WG R++  +G R
Sbjct: 127 RPLVTIIGDSLQARHDEWGGRVHDTLGTR 155


>SPBC354.01 |gtp1|SPBC649.06|GTP binding protein
          Gtp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 363

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 10/21 (47%), Positives = 15/21 (71%)
 Frame = -1

Query: 81 GRLSQFRTRLMSPG*KSGPGG 19
          G+L++ R +L+ P  KSGP G
Sbjct: 32 GKLAKLRAQLLEPTSKSGPKG 52


>SPCC4F11.04c |||mannosyltransferase complex subunit
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 345

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +2

Query: 365 VATSPLRPKVDWELFKRRLVDLPAIQD 445
           ++T PL     WE +KR+L + PA  D
Sbjct: 229 LSTGPLSISFLWEKYKRQLPNPPAFYD 255


>SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 885

 Score = 25.0 bits (52), Expect = 8.1
 Identities = 13/40 (32%), Positives = 23/40 (57%)
 Frame = +2

Query: 149 GRRLLEDADRGDYSVVGPDEPTHIPTAAQLQPDVLDVCVH 268
           G+ +L+  D  +Y+V GP+   ++P  AQL     DV ++
Sbjct: 181 GQFVLQALDH-NYAVYGPETVLNVPENAQLLVTEKDVIIY 219


>SPBC354.05c |sre2||membrane-tethered transcription factor
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 793

 Score = 25.0 bits (52), Expect = 8.1
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 354 PIPSVTRIGRWGVPRSYS 301
           PI  V  +G  G+PRSYS
Sbjct: 57  PISHVPSVGTRGIPRSYS 74


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,588,102
Number of Sequences: 5004
Number of extensions: 55345
Number of successful extensions: 160
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 151
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 159
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 252150250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).