SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0007
         (818 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25B8.15c |||wybutosine biosynthesis protein Tyw3|Schizosacch...    28   1.4  
SPAC23H3.09c |gly1||threonine aldolase |Schizosaccharomyces pomb...    27   3.2  
SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schiz...    27   4.2  
SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual    25   9.8  

>SPAC25B8.15c |||wybutosine biosynthesis protein
           Tyw3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 237

 Score = 28.3 bits (60), Expect = 1.4
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = -1

Query: 716 ATSRAQTYLARFFLC*IYPRSTDYFDSRTRR 624
           A+ + Q Y+ R ++C ++ RS +YF     R
Sbjct: 175 ASEKLQFYITREYMCFLFKRSVEYFTENGNR 205


>SPAC23H3.09c |gly1||threonine aldolase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 376

 Score = 27.1 bits (57), Expect = 3.2
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +2

Query: 515 ISMHCDF*NIRCNSAFKSSNYEVRCFCTSFD*RSYCL 625
           I +HCD    R   A  +SN  ++ +C+ FD  S CL
Sbjct: 190 IPLHCD--GARLWDAAVASNVSIKEYCSYFDSVSLCL 224


>SPCC553.07c |mug40||DinB translesion DNA repair
           polymerase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 547

 Score = 26.6 bits (56), Expect = 4.2
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 47  NIENIKVLLNTRRIDS*TVLPEKKNTQVFFFL 142
           N+E +K L+NT    + T+   K NT   +FL
Sbjct: 515 NVETVKSLINTDHTANPTIKKRKSNTLDTYFL 546


>SPAC630.13c |tsc2||tuberin|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1339

 Score = 25.4 bits (53), Expect = 9.8
 Identities = 15/72 (20%), Positives = 32/72 (44%)
 Frame = +2

Query: 128 VFFFLIIYYSMCTKSRS*TCYIILIYLFVHTKSFQYVLKKYIFKDLTVIKFNVVSNNILK 307
           +FF  +I YS+  K+      +IL   ++ T S+  + +  IF  ++    N+   N+  
Sbjct: 223 MFFDSMIRYSVIPKASLYDTVLILCSTYISTYSYSKLAQSVIFNLISSPVSNLAFENVFN 282

Query: 308 *FLIKRGHIKNI 343
                R ++  +
Sbjct: 283 ILQYNRSNVNAV 294


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,047,668
Number of Sequences: 5004
Number of extensions: 58749
Number of successful extensions: 106
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 106
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 400438000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).