SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC622.07 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual         28   1.9  
SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ...    27   3.4  
SPBC887.16 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual         26   7.8  

>SPCC622.07 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 128

 Score = 27.9 bits (59), Expect = 1.9
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)
 Frame = -1

Query: 228 HLFIYLSN-FLFLFYLINIVFFFFRYNNINSKC 133
           H  +Y+S  FLFL Y+++IV +   YN  +  C
Sbjct: 31  HRLLYISIIFLFLNYVVDIVCYVKNYNGFSFFC 63


>SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1854

 Score = 27.1 bits (57), Expect = 3.4
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 6/41 (14%)
 Frame = +3

Query: 375 VYVREPCLSLYFFGWQQSIQQSYLK------KKTPKTMAYL 479
           +Y  E  L +Y FG+      S+        KKTP+TM+YL
Sbjct: 226 LYTLEMLLKIYLFGFLYDGSSSFYDFINSYTKKTPRTMSYL 266


>SPBC887.16 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 109

 Score = 25.8 bits (54), Expect = 7.8
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -1

Query: 261 LCNEHFNNVYQHLFIYLSNFLFLFYLINIVFFF 163
           L    F N + +L     +F FLF+L+N + FF
Sbjct: 63  LAKTEFKNSFSNL-----HFFFLFWLLNFILFF 90


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,153,995
Number of Sequences: 5004
Number of extensions: 61346
Number of successful extensions: 107
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 104
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 107
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 422462090
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).