SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   271   6e-74
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...   137   2e-33
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...   122   4e-29
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...   116   4e-27
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    95   9e-21
SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po...    77   3e-15
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    73   4e-14
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    70   3e-13
SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb...    44   2e-05
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    28   1.5  
SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1...    26   6.2  
SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccha...    26   6.2  
SPBC31F10.10c |||zf-MYND type zinc finger protein|Schizosaccharo...    26   6.2  
SPAC1B3.17 |clr2||chromatin silencing protein Clr2|Schizosacchar...    25   8.2  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  271 bits (665), Expect = 6e-74
 Identities = 125/140 (89%), Positives = 131/140 (93%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFR PEALFQPS LG+E  GIHE TYNSIMKCDVDIRKDLY 
Sbjct: 236 LEKSYELPDGQVITIGNERFRAPEALFQPSALGLENAGIHEATYNSIMKCDVDIRKDLYG 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           N V+SGGTTMYPGIADRMQKEI ALAPS+MK+KI+APPERKYSVWIGGSILASLSTFQQM
Sbjct: 296 NVVMSGGTTMYPGIADRMQKEIQALAPSSMKVKIVAPPERKYSVWIGGSILASLSTFQQM 355

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGP IV+RKCF
Sbjct: 356 WISKQEYDESGPGIVYRKCF 375


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score =  137 bits (331), Expect = 2e-33
 Identities = 62/141 (43%), Positives = 94/141 (66%)
 Frame = -3

Query: 709 PLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLY 530
           P   +Y+LPD Q IT+G E F  PE LF P  +G EA G+H   + SI+  D+D+R  LY
Sbjct: 240 PQIHTYQLPDNQTITLGTECFSAPEVLFNPEMMGSEASGLHIQLFKSILLSDIDLRSTLY 299

Query: 529 ANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQ 350
           +N VLSGG+T+  G  +R   E+ A++    ++KI A PER ++ W+GGSILASLSTF++
Sbjct: 300 SNIVLSGGSTLLRGFGERFISELRAISGKKNQVKIYASPERMHNAWLGGSILASLSTFRR 359

Query: 349 MWISKQEYDESGPSIVHRKCF 287
           + I+ +EY ++  +++ R+ F
Sbjct: 360 LLITSEEY-KNDQNVIFRRRF 379


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score =  122 bits (295), Expect = 4e-29
 Identities = 63/143 (44%), Positives = 93/143 (65%), Gaps = 12/143 (8%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           L ++Y LPDG+VI +G+ER+ CPE LFQP  +G E  G+ E  +++I   DVDIRK LY 
Sbjct: 236 LMRNYTLPDGRVIKVGSERYECPECLFQPHLVGSEQPGLSEFIFDTIQAADVDIRKYLYR 295

Query: 526 NTVLSGGTTMYPGIADRMQKEITAL--------APSTM---KIKIIAPPERKYSVWIGGS 380
             VLSGG++MY G+  R++KEI  L         P+ +   K+KI   P R+++V+IGG+
Sbjct: 296 AIVLSGGSSMYAGLPSRLEKEIKQLWFERVLHGDPARLPNFKVKIEDAPRRRHAVFIGGA 355

Query: 379 ILAS-LSTFQQMWISKQEYDESG 314
           +LA  ++    MW+SK E++E G
Sbjct: 356 VLADIMAQNDHMWVSKAEWEEYG 378


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score =  116 bits (278), Expect = 4e-27
 Identities = 60/140 (42%), Positives = 80/140 (57%), Gaps = 11/140 (7%)
 Frame = -3

Query: 700 KSYELPDGQVITIGNERFRCPEALFQPSFLGMEAC---------GIHETTYNSIMKCDVD 548
           K +E PDG     G ERFR  E LF PSF    +          G+HE  Y SI+ CD +
Sbjct: 279 KPFEFPDGVTHKFGQERFRISEILFNPSFSASRSAETTPPQGSVGLHELVYQSILACDSE 338

Query: 547 IRKDLYANTVLSGGTTMYPGIADRMQKEITALAP-STMKIKII-APPERKYSVWIGGSIL 374
           +R  L  N V++GGT++ PG+++R+Q E+  LA  S + +           +VW GGSIL
Sbjct: 339 LRSPLLNNIVVTGGTSLIPGLSERLQAEVQRLATGSRINVHTAETASATSNAVWFGGSIL 398

Query: 373 ASLSTFQQMWISKQEYDESG 314
           ASL  FQ +W+SKQEYDE G
Sbjct: 399 ASLDNFQHLWVSKQEYDEVG 418


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 95.1 bits (226), Expect = 9e-21
 Identities = 47/108 (43%), Positives = 71/108 (65%), Gaps = 6/108 (5%)
 Frame = -3

Query: 595 GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 416
           GI +   N I +CDVDIR  L  N ++ GGT++  G + R+Q E++ L P + ++KI A 
Sbjct: 326 GIPQLFQNCISECDVDIRASLLNNVIVCGGTSLMQGFSLRLQNELSKLYPGS-RLKIHAS 384

Query: 415 P---ERKYSVWIGGSILASLSTFQQMWISKQEYDESGP---SIVHRKC 290
               ER Y+ W+GGSIL+SL TF Q+WIS+QEY+E G    +++ ++C
Sbjct: 385 GHVVERSYASWLGGSILSSLGTFHQLWISRQEYEEHGSDRLALIEKRC 432


>SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 401

 Score = 77.0 bits (181), Expect = 3e-15
 Identities = 42/128 (32%), Positives = 64/128 (50%)
 Frame = -3

Query: 676 QVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTM 497
           QV+ + NERF  PE LF PS + +   GI E    S+     +I+  L  N V  GG   
Sbjct: 272 QVLNLSNERFMIPELLFSPSDIEIREAGIPEAVMQSVTHFPENIQAMLLENVVTIGGNCK 331

Query: 496 YPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDES 317
           +PG   R+  E+ +LAP+  ++K+  P +     W   S +  L  +    I++ EY E 
Sbjct: 332 FPGFHKRLSSELRSLAPANWEVKVFEPSDPICFPWKKASHM-PLEHWNANKITRSEYSEH 390

Query: 316 GPSIVHRK 293
           G +I+ RK
Sbjct: 391 GANIMTRK 398


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 72.9 bits (171), Expect = 4e-14
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 15/140 (10%)
 Frame = -3

Query: 670 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 494
           I +G ERF  PE  F P     +    + E   N +    +D+RK LY N VLSGG+T++
Sbjct: 280 IDVGFERFLAPEIFFNPEIASSDFLTPLPELVDNVVQSSPIDVRKGLYKNIVLSGGSTLF 339

Query: 493 PGIADRMQKEITALAPST--------------MKIKIIAPPERKYSVWIGGSILASLSTF 356
               +R+Q+++  +                  + + +I+   ++ +VW GGS+LA    F
Sbjct: 340 KNFGNRLQRDLKRIVDERIHRSEMLSGAKSGGVDVNVISHKRQRNAVWFGGSLLAQTPEF 399

Query: 355 QQMWISKQEYDESGPSIVHR 296
                +K +Y+E G SI  R
Sbjct: 400 GSYCHTKADYEEYGASIARR 419


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 70.1 bits (164), Expect = 3e-13
 Identities = 31/118 (26%), Positives = 62/118 (52%)
 Frame = -3

Query: 655 ERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADR 476
           E+ R PE +F PS +G++  GI E   + + +  ++ ++ L +N +++GG    PG+  R
Sbjct: 594 EQIRVPEVIFSPSIVGIDQAGILEIMRSILQRHSLEEQQKLVSNVLITGGLGSLPGMETR 653

Query: 475 MQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV 302
           +++E+T++ P    I +          W G S  +    F+   ++++EY E GP  +
Sbjct: 654 IKRELTSIMPVGSSINVFRASNPLLDAWKGASEWSVTEKFKAAKVTREEYLEKGPEYI 711


>SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 44.4 bits (100), Expect = 2e-05
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 3/86 (3%)
 Frame = -3

Query: 541 KDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPP---ERKYSVWIGGSILA 371
           K+LY++ ++ GG   +PG A  +++ I +   +   I +I PP   + ++  W G  I  
Sbjct: 527 KNLYSSILIVGGAGQFPGFAHLLEERIHSKRANIPTISVIPPPRSMDAQFVAWKGACIYN 586

Query: 370 SLSTFQQMWISKQEYDESGPSIVHRK 293
            +    ++WI   ++   G  ++  K
Sbjct: 587 RIRIVSELWIKNSDWKMLGSRVLQYK 612


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 12/37 (32%), Positives = 24/37 (64%), Gaps = 3/37 (8%)
 Frame = -3

Query: 394 WIGGSILASLSTFQQM---WISKQEYDESGPSIVHRK 293
           ++GGSI+A  S  + +   +++ +EY + GP+ +H K
Sbjct: 486 FLGGSIVAKTSFNESVSSHYVTLEEYAQHGPTAIHTK 522


>SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 574

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = -1

Query: 402 TPYGSVDRSSPPSLPSNRCGSRNRSTTSLAPP 307
           TP  +     PPS+PS+R   R  S ++ APP
Sbjct: 223 TPTSTSAPPIPPSIPSSRPPERVPSLSAPAPP 254


>SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 617

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -3

Query: 469 KEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST 359
           KEI++ A S + +  + P E+    W    ILA L+T
Sbjct: 212 KEISSQARSNIALPTLRPQEKNLIDWRDRKILAPLTT 248


>SPBC31F10.10c |||zf-MYND type zinc finger
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 574

 Score = 25.8 bits (54), Expect = 6.2
 Identities = 13/29 (44%), Positives = 19/29 (65%)
 Frame = -1

Query: 711 PPSRSLTNFPTVRSSLSETKDSVAQRLSS 625
           PPS +   FP + S++S + DSV+Q  SS
Sbjct: 147 PPSSASAPFP-INSNISNSLDSVSQHNSS 174


>SPAC1B3.17 |clr2||chromatin silencing protein
           Clr2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 537

 Score = 25.4 bits (53), Expect = 8.2
 Identities = 17/62 (27%), Positives = 30/62 (48%)
 Frame = -2

Query: 512 RWYHHVPWNRRPYAKGNHSSRPIDNED*DHCSSREEVLRMDRWIDPRLPLYLPTDVDLET 333
           RWY   PW    + KG+ +     +E  +  SSR   +  + W+D     YL +++D+ +
Sbjct: 483 RWYE--PW----FVKGDLN---YTSEVKERTSSRLSAVGSENWVDDDFYEYLLSEIDMVS 533

Query: 332 GV 327
            V
Sbjct: 534 AV 535


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,913,516
Number of Sequences: 5004
Number of extensions: 59727
Number of successful extensions: 190
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 177
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 183
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 335201398
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).