SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0002
         (698 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c...    29   0.48 
SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual    26   6.0  
SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch...    25   7.9  

>SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 288

 Score = 29.5 bits (63), Expect = 0.48
 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 9/60 (15%)
 Frame = -1

Query: 194 YFVGFQN-SEVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 42
           Y VG+ N + ++++   WGHS+ +V  E+L        +QD  E ++K+L ++ +S + +
Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201


>SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 978

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = -1

Query: 149 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 42
           NW   +  ++G I  SSQ E    +L KV  SI +E
Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157


>SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 845

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = +3

Query: 558 LIPITRPRKSPVSIFFVTTSPCREWVICAPAAFL 659
           +IPI +  KS +S+ F+T SPC  + IC+  A L
Sbjct: 45  IIPIAQ--KSNISLPFLTLSPC-SFTICSLRARL 75


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,690,094
Number of Sequences: 5004
Number of extensions: 52161
Number of successful extensions: 122
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 122
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).