SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1071.07c |rps1502|rps15-2, rps15|40S ribosomal protein S15|S...    97   3e-21
SPCC1393.03 |rps1501|rps15-1|40S ribosomal protein S15|Schizosac...    97   4e-21
SPAC1751.02c |rsm19||mitochondrial ribosomal protein subunit S19...    31   0.24 
SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces po...    28   1.7  
SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|ch...    28   2.2  
SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces pombe...    27   2.9  
SPCC320.10 |srp72||signal recognition particle subunit Srp72|Sch...    27   3.8  
SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ...    26   6.7  
SPAP19A11.05c |mrp7||mitochondrial ribosomal protein subunit L27...    26   6.7  

>SPAC1071.07c |rps1502|rps15-2, rps15|40S ribosomal protein
           S15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 154

 Score = 97.1 bits (231), Expect = 3e-21
 Identities = 46/76 (60%), Positives = 54/76 (71%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           +EQL++L H         GL       ++KLR+AK EAP NEKP  VKTHLRNMII+PEM
Sbjct: 39  AEQLVDLFHARARRRMLRGLGPNASRFIRKLRKAKSEAPLNEKPATVKTHLRNMIILPEM 98

Query: 635 VGSIVGIYNGKTFNQV 682
           VGS+VGIYNGK FNQV
Sbjct: 99  VGSVVGIYNGKLFNQV 114



 Score = 39.1 bits (87), Expect = 9e-04
 Identities = 16/23 (69%), Positives = 20/23 (86%)
 Frame = +3

Query: 171 LKKKRIFRKFTYRGVDLDQLLDM 239
           L+KKR FR F YRGV+L+QLLD+
Sbjct: 15  LRKKRTFRTFAYRGVELEQLLDL 37


>SPCC1393.03 |rps1501|rps15-1|40S ribosomal protein
           S15|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 153

 Score = 96.7 bits (230), Expect = 4e-21
 Identities = 46/76 (60%), Positives = 54/76 (71%)
 Frame = +2

Query: 455 SEQLMELMHXXXXXXXXXGLKRKPMALVKKLRRAKKEAPPNEKPEIVKTHLRNMIIVPEM 634
           +EQL++L H         GL       ++KLR+AK EAP NEKP  VKTHLRNMII+PEM
Sbjct: 38  AEQLVDLFHARARRRMLRGLGPNASRFIRKLRKAKTEAPLNEKPATVKTHLRNMIILPEM 97

Query: 635 VGSIVGIYNGKTFNQV 682
           VGS+VGIYNGK FNQV
Sbjct: 98  VGSVVGIYNGKLFNQV 113



 Score = 38.7 bits (86), Expect = 0.001
 Identities = 16/23 (69%), Positives = 20/23 (86%)
 Frame = +3

Query: 171 LKKKRIFRKFTYRGVDLDQLLDM 239
           L+KKR FR F YRGV+L+QLLD+
Sbjct: 14  LRKKRSFRTFAYRGVELEQLLDL 36


>SPAC1751.02c |rsm19||mitochondrial ribosomal protein subunit
           S19|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 108

 Score = 31.1 bits (67), Expect = 0.24
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +2

Query: 593 VKTHLRNMIIVPEMVGSIVGIYNGKTFNQVR 685
           +KT +R+  I+P MVG+   ++NGK++  V+
Sbjct: 50  IKTAVRSATILPRMVGAQFMVHNGKSYANVK 80


>SPAC3G9.08 |png1||ING family homolog Png1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 283

 Score = 28.3 bits (60), Expect = 1.7
 Identities = 12/40 (30%), Positives = 25/40 (62%), Gaps = 2/40 (5%)
 Frame = -2

Query: 685 AYLVKSF--SVVNADN*TDHLGNDDHVSQVSLHDLWLLIR 572
           AY++  +  ++ N  N T H+ ++  V +V++HD+W  I+
Sbjct: 6   AYILSEYLQTLDNVPNETKHIFDEISVKEVAVHDIWKRIQ 45


>SPBC18H10.21c ||SPBC9B6.01c|dubious|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 157

 Score = 27.9 bits (59), Expect = 2.2
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +2

Query: 560 KEAPPNEKPEIVKTHLRNMIIVPEMVGSIVGIYN 661
           K A P++KP +  THL +++I    VG  +  ++
Sbjct: 60  KRARPSQKPPLRSTHLPHLLIFALFVGKHIACFH 93


>SPAC20G4.05c |||UPF0061 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 568

 Score = 27.5 bits (58), Expect = 2.9
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = -2

Query: 370 IKAYFTYNSSV*NMTVNSYKNPLTSNFFDTLHLR 269
           +K  F Y S V    V  YKN + ++F+D +  R
Sbjct: 368 LKKAFAYTSEVFEKIVEEYKNIVQNDFYDLMFKR 401


>SPCC320.10 |srp72||signal recognition particle subunit
           Srp72|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 561

 Score = 27.1 bits (57), Expect = 3.8
 Identities = 13/48 (27%), Positives = 24/48 (50%)
 Frame = +2

Query: 62  LQILSVLYRQQYVKNLKTVLFKKSEQLCLCFSGRRNPQEKAYFQEVHL 205
           L  L    ++Q+++NL  +     +Q  +    +RNP+E  YF  + L
Sbjct: 252 LSSLLASQKKQFIRNLALLDMAVGKQRSVRKEKKRNPEESIYFSTILL 299


>SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 2344

 Score = 26.2 bits (55), Expect = 6.7
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = -1

Query: 212 SPVSELPENTLFLEGFVDLKNINIVAHFS*IALF*DSSHIADD 84
           SP +E P  + F    + L  +NI+A F  + +  ++ H+AD+
Sbjct: 529 SPSTERPPRSSFSAALMTL--LNIIASFKKVTMVIENIHLADE 569


>SPAP19A11.05c |mrp7||mitochondrial ribosomal protein subunit
           L27|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 153

 Score = 26.2 bits (55), Expect = 6.7
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +3

Query: 132 VSNYVYVFQVDETLKKKRIFRKFTYRGVDLDQLLDMPK 245
           VS YV  FQ+D +L+K+R      Y GV  D+   +P+
Sbjct: 98  VSGYVKFFQMDVSLRKRR-----KYVGVVFDKETTLPR 130


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,510,837
Number of Sequences: 5004
Number of extensions: 66723
Number of successful extensions: 135
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 129
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 135
length of database: 2,362,478
effective HSP length: 73
effective length of database: 1,997,186
effective search space used: 481321826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).