BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0131 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosa... 28 1.1 SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pomb... 26 4.5 SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces p... 26 6.0 SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pom... 26 6.0 SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schi... 25 7.9 SPCC1393.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 25 7.9 >SPBC418.02 |||NatA N-acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -3 Query: 579 VRIVI*TIFIFKVLFETKFNMYG 511 +R + + I+ +LFE+KFNMYG Sbjct: 547 LRATLGALTIYLLLFESKFNMYG 569 >SPAC3H8.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1073 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 191 LFVPPRKLRQECWSYLSLFDSSKS 262 +FVPP++ C +Y+ LF S S Sbjct: 173 IFVPPKRSSSSCVTYVCLFLDSNS 196 >SPAC11E3.05 |||ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1323 Score = 25.8 bits (54), Expect = 6.0 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 215 RQECWSYLSLFDSSKSVCKKEKKYIDGELVVSRGCTWKRQDDF 343 RQ+ + + DSS SV + D E ++RG T + +F Sbjct: 866 RQKLFESFGVLDSSNSVADSDSTNYDDENSLNRGGTSESDSEF 908 >SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pombe|chr 3|||Manual Length = 534 Score = 25.8 bits (54), Expect = 6.0 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 260 SVCKKEKKYIDGELVVSRGCTWKRQDDFE 346 +V + Y++ E+V + W+R DFE Sbjct: 32 TVTSSDGSYVEYEIVHQKRSVWRRYSDFE 60 >SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 984 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 169 ILKGSLHSGFTLDEHAQQFTGSLSFT 92 ++ SLH+ F + HA TG LS T Sbjct: 897 VVVNSLHNYFFAEAHASSVTGVLSIT 922 >SPCC1393.05 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 956 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 115 FTGSLSFTNSARSKTGTRNDSFAIMMHNKLTRLS 14 F GSL FT+ R+KT F+++ +KL + + Sbjct: 730 FKGSLLFTDDKRNKTEDSTVFFSMICSSKLDQFA 763 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,583,028 Number of Sequences: 5004 Number of extensions: 47928 Number of successful extensions: 153 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -