SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p...    30   0.30 
SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces ...    27   2.8  
SPAC23D3.11 |ayr1||1-acyldihydroxyacetone phosphate reductase |S...    26   4.9  
SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch...    25   6.5  

>SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 226

 Score = 29.9 bits (64), Expect = 0.30
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 5/76 (6%)
 Frame = +2

Query: 401 FTTNSYGVGLVSKLIKPKTVVQFYISCFSTIKHATISKV*ALLSASFLTFTRSRTLQKLA 580
           F+  S+G+ +  K+    ++V F++ CF  + +A       +++ SF+       L  + 
Sbjct: 20  FSAISFGISIYIKVFGRSSIVTFFLLCFHLVPNALFLFPWTIITTSFVDANVFTLLSSIL 79

Query: 581 ISTPVG-----KWFHK 613
           I +  G      W HK
Sbjct: 80  ILSVYGVEIERSWGHK 95


>SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 580

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +2

Query: 524 LLSASFLTFTRSRTLQKLAISTPVGKWF 607
           L +A+ +T+T SRTL  +A      KWF
Sbjct: 372 LTAANGITYTGSRTLHSMAEQGHAPKWF 399


>SPAC23D3.11 |ayr1||1-acyldihydroxyacetone phosphate reductase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 296

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -2

Query: 330 RPLHTVTDEREKNTTLYLKYRVFIIEN-NGAKQF 232
           +PL T+T+      ++Y  YR  I+EN N  ++F
Sbjct: 188 KPLGTMTEAAIPENSIYYPYRKLILENRNPVEKF 221


>SPCC663.03 |pmd1||leptomycin efflux transporter
           Pmd1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1362

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 7/24 (29%), Positives = 14/24 (58%)
 Frame = -2

Query: 261 IIENNGAKQFNNSVSQMCIHYIYV 190
           +    GA  F ++V   C+++IY+
Sbjct: 126 LASGKGASSFQHTVDHFCLYFIYI 149


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,331,471
Number of Sequences: 5004
Number of extensions: 44402
Number of successful extensions: 106
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 101
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 106
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 267622334
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).