SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   178   6e-46
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...   103   2e-23
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    95   5e-21
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    95   5e-21
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    64   2e-11
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    63   3e-11
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    50   2e-07
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    35   0.011
SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce...    32   0.076
SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces p...    29   0.71 
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    27   2.8  
SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces p...    26   3.8  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    26   3.8  
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    26   5.0  
SPCC757.05c |||acetylornithine deacetylase |Schizosaccharomyces ...    25   6.6  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  178 bits (433), Expect = 6e-46
 Identities = 87/119 (73%), Positives = 91/119 (76%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTE
Sbjct: 48  GQKDSYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTE 107

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPK+NREKMTQI+FETFN PA YVAIQA                SGD G+ H  PI
Sbjct: 108 APLNPKSNREKMTQIIFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGD-GVTHTVPI 165



 Score =  106 bits (254), Expect = 3e-24
 Identities = 46/51 (90%), Positives = 50/51 (98%)
 Frame = +1

Query: 100 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDS
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDS 52


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score =  103 bits (248), Expect = 2e-23
 Identities = 48/124 (38%), Positives = 78/124 (62%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP 401
           + G    + ++VGDEA++ R +L +KYP+E+GI+ ++++M ++W +TF+ +L++ P    
Sbjct: 43  KTGNVQIKDVMVGDEAEAVRSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRK 102

Query: 402 VLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPH 581
           +LLTE P+NP ANREKM + MFE +    +YVAIQA        +       SGD G+ H
Sbjct: 103 ILLTEPPMNPVANREKMCETMFERYGFGGVYVAIQAVLSLYAQGLSSGVVVDSGD-GVTH 161

Query: 582 PCPI 593
             P+
Sbjct: 162 IVPV 165



 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 21/35 (60%), Positives = 26/35 (74%)
 Frame = +1

Query: 106 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 210
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRP 36


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 95.5 bits (227), Expect = 5e-21
 Identities = 41/86 (47%), Positives = 55/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 VGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 431
           +G++A  K     +L YPI HG + NWD ME+ W  + +  LR  PE+H  LLTE PLNP
Sbjct: 76  IGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNP 135

Query: 432 KANREKMTQIMFETFNTPAMYVAIQA 509
             NRE   +IMFE+FN   +Y+A+QA
Sbjct: 136 PENRENTAEIMFESFNCAGLYIAVQA 161



 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 14/28 (50%), Positives = 23/28 (82%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIV 201
           +++DNG+G  K G+AG+DAP  VFP+++
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVI 35


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 95.5 bits (227), Expect = 5e-21
 Identities = 48/116 (41%), Positives = 67/116 (57%), Gaps = 1/116 (0%)
 Frame = +3

Query: 249 LLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPL 425
           + VG EAQ+ RG+L ++ PIE GI+ NW DME+IW + + + +L   PEEHP+LLTE PL
Sbjct: 56  MFVGSEAQNLRGLLKIQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPL 115

Query: 426 NPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
               N+EK+ +  +ET N PA+  ++Q                  GD GL H  PI
Sbjct: 116 ANIRNKEKIAEYFYETLNVPALSFSLQPVLALYASARTTGIVLECGD-GLTHSVPI 170



 Score = 58.8 bits (136), Expect = 6e-10
 Identities = 25/44 (56%), Positives = 32/44 (72%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD 249
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKD 55


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 63.7 bits (148), Expect = 2e-11
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)
 Frame = +3

Query: 228 GRYGTEGLLVGDEAQSKRGI-LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 404
           G +     L G+E   K    + +K  I +G V NWD    +W +    +L+  P EHP+
Sbjct: 42  GEFSDGRRLFGEEYIYKSNPGMEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPI 101

Query: 405 LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQ 506
           L+TE   NP  NR K  + MFE+   PA Y+A Q
Sbjct: 102 LITEPFDNPPENRVKTLETMFESLRCPATYLAKQ 135



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 31/95 (32%), Positives = 54/95 (56%), Gaps = 1/95 (1%)
 Frame = +3

Query: 222 RDGRYGTEGLLVGDEAQSKRGILTL-KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH 398
           RD +      LVG++   + G  ++ + P E  +++NWD ME++  +TF  +L +   EH
Sbjct: 58  RDRKLSRTSTLVGNDTLIEVGSRSIARSPFERNVISNWDLMEQVLDYTFL-KLGIDRMEH 116

Query: 399 PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAI 503
           P+ +TE   NP   R  MT+++FE +N P++   I
Sbjct: 117 PICMTEPLANPTYVRSTMTELLFELYNAPSVAYGI 151



 Score = 35.9 bits (79), Expect = 0.005
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 118 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 213
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +3

Query: 255 VGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN 428
           V DE Q    I  + +K    +GI+ +W+     W      +L+V P E+ +++TE   N
Sbjct: 53  VVDELQIHAPIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWN 112

Query: 429 PKANREKMTQIMFETFNTPAMYVAIQA 509
           P++ R+++ +  FE  + PA Y+  QA
Sbjct: 113 PQSVRQQIMEAAFEQLHVPAFYLTKQA 139



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 103 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 204
           EE+ +LV+D GS   + G+AG+++P  + PS  G
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYG 41


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 34.7 bits (76), Expect = 0.011
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 4/72 (5%)
 Frame = +3

Query: 303 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 470
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 471 TFNTPAMYVAIQ 506
               P   +A +
Sbjct: 172 ECQVPGFTIAYE 183


>SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1666

 Score = 31.9 bits (69), Expect = 0.076
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = +3

Query: 363  FYNELRVAPEEHPVLLTE--APLNPKANREKMTQIMFETFNTPAM---YVAIQ 506
            +Y  L    E+HP+LLT+  A L P+ +  ++ +I  ++ NTP +    VAIQ
Sbjct: 1399 YYRALNFYLEQHPMLLTDLLAALTPRIDHPRVIRIFEKSENTPLILNFMVAIQ 1451


>SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 277

 Score = 28.7 bits (61), Expect = 0.71
 Identities = 19/66 (28%), Positives = 29/66 (43%)
 Frame = -3

Query: 335 IPVSDDSVFDGVFEGQDTSFALCLISY*ESFCPIPTITP*WRGLPTIEGNTARGASSPAK 156
           +P  + +V        +TSFAL   S   S    PT +      P +E +    +S+PA 
Sbjct: 63  LPTQEAAVETNASASHETSFALPTTSPAASLSISPTKSAAVSSEPNVEADVKSLSSTPAA 122

Query: 155 PALHIP 138
           P L+ P
Sbjct: 123 PQLNSP 128


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = -3

Query: 233 PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 99
           PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 411 PTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455


>SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 226

 Score = 26.2 bits (55), Expect = 3.8
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +3

Query: 405 LLTEAPLNPKANREKMTQIMFETFN 479
           +L  APL+ +   +KM +++FET+N
Sbjct: 181 VLETAPLHAEEVSKKMKELLFETYN 205


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.2 bits (55), Expect = 3.8
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -3

Query: 239 PIPTITP*WRGLPTIEGNTARGASSPAKPAL 147
           P+PT  P    LPT   NT +    P+ PAL
Sbjct: 74  PVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 25.8 bits (54), Expect = 5.0
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = -1

Query: 256 TKSPSVPYRPSRPDGGAFPRSRGTR 182
           +K+PS PY  SRP   A   S  TR
Sbjct: 311 SKAPSYPYSSSRPSASASLASSPTR 335


>SPCC757.05c |||acetylornithine deacetylase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 400

 Score = 25.4 bits (53), Expect = 6.6
 Identities = 10/25 (40%), Positives = 14/25 (56%)
 Frame = -1

Query: 511 HAWMATYMAGVLNVSNMIWVIFSLL 437
           H WM+  +AG LN   + W   S+L
Sbjct: 17  HLWMSPVLAGPLNFGYLSWGQHSIL 41


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,822,106
Number of Sequences: 5004
Number of extensions: 62243
Number of successful extensions: 193
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 171
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 188
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 269634532
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).