SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3 |Schizosacchar...    28   1.2  
SPCP1E11.06 |apl4||AP-1 adaptor complex gamma subunit Apl4 |Schi...    27   1.6  
SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces p...    27   1.6  
SPCC364.04c |||CASP family protein|Schizosaccharomyces pombe|chr...    27   2.1  
SPCC417.08 |tef3||translation elongation factor eEF3|Schizosacch...    27   2.1  
SPBC577.15c |||NASP family histone binding protein|Schizosacchar...    26   4.9  
SPAC17G6.11c |||glucosidase |Schizosaccharomyces pombe|chr 1|||M...    25   6.4  
SPBC902.05c |idh2|glu2|isocitrate dehydrogenase |Schizosaccharom...    25   8.5  

>SPAC6F12.05c |tnr3||thiamine diphosphokinase Tnr3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 569

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +2

Query: 365 SRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRRW 469
           S++ E C PA P +++   APC +   D  T +++
Sbjct: 319 SKKAETCVPAKPQKATHQLAPCKAWLRDYDTDQKF 353


>SPCP1E11.06 |apl4||AP-1 adaptor complex gamma subunit Apl4
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 865

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 20/64 (31%), Positives = 31/64 (48%)
 Frame = -1

Query: 416 HQNFEQELQANKPRVDEITAVGKRLLELEHFAQPQISSRVEELGGIWERLVQSSS*RETS 237
           +QN EQ+L+ANK  V++       LL+L     P ++  +E       +  QSS  R  S
Sbjct: 630 YQNAEQKLKANK-HVEKRVQESNELLDLIGLTTPSVAEPLETPVDEMTQSPQSSLSRAPS 688

Query: 236 CRKR 225
             K+
Sbjct: 689 TSKK 692


>SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 598

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -1

Query: 599 LLLEKSRTKRPRSPWKDRPTKYQQ 528
           L++++    R RS WK  P KYQQ
Sbjct: 552 LMVDEKEMARRRSVWKAPPLKYQQ 575


>SPCC364.04c |||CASP family protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 633

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = -3

Query: 237 LQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKHALLEADVSSHAER 58
           L EAA   +  + +ED++    E+EG L  ++  K    V+NL+K+    +  V + AE+
Sbjct: 110 LIEAANNLKTQKQIEDLKKEKEEMEGSLQGKE--KLEREVENLRKELDKYKDLVETEAEK 167

Query: 57  IDAI 46
             AI
Sbjct: 168 RAAI 171


>SPCC417.08 |tef3||translation elongation factor
           eEF3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1047

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +1

Query: 4   KWFPFL*TGSAWFPYGVDAFGVRAHVGLQQRVLLLEILHAGQILPVVLAE 153
           +W P + + +AW P G     +  H  +   V   E L +GQ  P+V  E
Sbjct: 835 RWVPMMSSDNAWLPRGE---LMETHAKMVAEVDRAEALKSGQFRPLVRKE 881


>SPBC577.15c |||NASP family histone binding
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 396

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 2/67 (2%)
 Frame = -3

Query: 249 KGNKLQEAAQQQQYNRAVEDIELWLSEVEGQLLSEDYGKDLTSVQNLQKKH--ALLEADV 76
           K  K ++ A++      +E++   LSE+E + L   +G        + K H  +LL  D 
Sbjct: 291 KKGKGKQKAEESTLTSDLENLREMLSELEQKTLDLKHGAPSLEEAVMSKMHESSLLSKDS 350

Query: 75  SSHAERI 55
           SS A+ +
Sbjct: 351 SSLAQAV 357


>SPAC17G6.11c |||glucosidase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 636

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = +2

Query: 452 STSRRWRTFSFLVYPTFSFITIAFRTVDTL*G 547
           S S ++  F   +YP + F+TI  ++V  + G
Sbjct: 441 SQSAQYAPFDLYMYPNYDFVTIYNQSVSAMNG 472


>SPBC902.05c |idh2|glu2|isocitrate dehydrogenase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 378

 Score = 25.0 bits (52), Expect = 8.5
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +2

Query: 41  SRMASMRSACELTSASNSACFFWRF 115
           S ++++R+A  L + S SAC+ +RF
Sbjct: 2   SMLSTLRTAGSLRTFSRSACYSFRF 26


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,334,118
Number of Sequences: 5004
Number of extensions: 44517
Number of successful extensions: 138
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 138
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 264253462
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).