SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   100   2e-22
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    55   3e-09
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...    46   2e-06
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    40   1e-04
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    39   3e-04
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    35   0.004
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    31   0.048
SPBC713.12 |erg1||squalene monooxygenase Erg1 |Schizosaccharomyc...    30   0.11 
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    28   0.59 
SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual    26   2.4  
SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S...    26   2.4  
SPBC1683.09c |frp1||ferric-chelate reductase Frp1|Schizosaccharo...    25   4.2  
SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po...    25   5.5  
SPBC1711.07 |||WD repeat protein Rrb1 |Schizosaccharomyces pombe...    25   5.5  
SPBC119.08 |pmk1|spm1|MAP kinase Pmk1 |Schizosaccharomyces pombe...    24   9.7  
SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|ch...    24   9.7  
SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|c...    24   9.7  
SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier ...    24   9.7  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score = 99.5 bits (237), Expect = 2e-22
 Identities = 42/47 (89%), Positives = 44/47 (93%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRH G+MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI  NWDDM
Sbjct: 36  GRPRHHGIMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVNNWDDM 82



 Score = 72.9 bits (171), Expect = 2e-14
 Identities = 32/37 (86%), Positives = 35/37 (94%)
 Frame = +2

Query: 149 DEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           +EE+AALV+DNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP 38


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 55.2 bits (127), Expect = 3e-09
 Identities = 24/47 (51%), Positives = 32/47 (68%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+ +H+ VM    QKD +VG EAQ+ RG+L ++ PIE GI  NW DM
Sbjct: 40  GRIKHERVMPSSIQKDMFVGSEAQNLRGLLKIQRPIERGIIQNWSDM 86



 Score = 43.2 bits (97), Expect = 1e-05
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           + +DNGSG  KAGFAG D P+ +FP+ VG
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVG 40


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score = 46.0 bits (104), Expect = 2e-06
 Identities = 21/39 (53%), Positives = 27/39 (69%)
 Frame = +2

Query: 155 EVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           E A +V+DNG+G  K G+A  + PR  FPSIVG P +RA
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRA 40



 Score = 40.3 bits (90), Expect = 1e-04
 Identities = 16/33 (48%), Positives = 26/33 (78%)
 Frame = +1

Query: 292 KDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           KD  VGDEA++ R +L +KYP+E+GI  ++++M
Sbjct: 50  KDVMVGDEAEAVRSLLQVKYPMENGIIRDFEEM 82


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 39.9 bits (89), Expect = 1e-04
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIVGS 256
           +++DNG+G  K G+AG DAP  VFP+++ +
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIAT 37



 Score = 32.3 bits (70), Expect = 0.028
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)
 Frame = +1

Query: 295 DSYVGDEAQSKRGI-LTLKYPIEHGIATNWDDM 390
           D ++G++A  K     +L YPI HG   NWD M
Sbjct: 73  DFFIGNDALKKASAGYSLDYPIRHGQIENWDHM 105


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 38.7 bits (86), Expect = 3e-04
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           +EV+A+V+D GS   + GF+G D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 35.1 bits (77), Expect = 0.004
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVG 253
           EE+ +LV+D GS   + G+AG ++P  + PS  G
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYG 41


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 31.5 bits (68), Expect = 0.048
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAGYDAPRAVFPSIV 250
           LV+DNGS   +AG+ G   P+ VF ++V
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLV 54


>SPBC713.12 |erg1||squalene monooxygenase Erg1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 457

 Score = 30.3 bits (65), Expect = 0.11
 Identities = 15/35 (42%), Positives = 20/35 (57%)
 Frame = -2

Query: 292 SVPYRPSRPDGGASHDRGKHCARSIISCEAGLAHT 188
           SVPY PS+P+GGA    G H  R +++    L  T
Sbjct: 87  SVPY-PSKPNGGAYQGIGFHYGRFVMNLRKALTST 120


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 27.9 bits (59), Expect = 0.59
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -2

Query: 319 VPHLLHKSPSVPYRPSRPDGGAS 251
           +  L+ K+PS PY  SRP   AS
Sbjct: 306 IDQLISKAPSYPYSSSRPSASAS 328


>SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1828

 Score = 25.8 bits (54), Expect = 2.4
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -1

Query: 194 TYRSHCLLPTRQLLRRTS*ISEI 126
           TYR H  +PT  LL  T  +SEI
Sbjct: 168 TYRDHDAIPTATLLNPTLDVSEI 190


>SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase
           Tor2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2337

 Score = 25.8 bits (54), Expect = 2.4
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = -3

Query: 348 FEGQDTSFALCLISYIRVLLSHTDHHA 268
           +EG+DT+      +Y+R++L  TD  A
Sbjct: 74  YEGEDTTRITRFANYLRIILPGTDQKA 100


>SPBC1683.09c |frp1||ferric-chelate reductase
           Frp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 564

 Score = 25.0 bits (52), Expect = 4.2
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +1

Query: 271 VMVGMGQKDSYVGDEAQSKRGILTLKYPI 357
           +M+G     +Y+G  AQ KR +LT +  I
Sbjct: 165 IMIGAIHGFAYIGLAAQGKRALLTARVTI 193


>SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 401

 Score = 24.6 bits (51), Expect = 5.5
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +2

Query: 167 LVVDNGSGMCKAGFAG 214
           +V+DNG+   KAGFAG
Sbjct: 8   IVLDNGAYHIKAGFAG 23


>SPBC1711.07 |||WD repeat protein Rrb1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 480

 Score = 24.6 bits (51), Expect = 5.5
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +2

Query: 239 PSIVGSPAIRA*WSVWDRRTL 301
           P+++ + A    WSVWD R+L
Sbjct: 350 PNLLATGADNGVWSVWDLRSL 370


>SPBC119.08 |pmk1|spm1|MAP kinase Pmk1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 422

 Score = 23.8 bits (49), Expect = 9.7
 Identities = 9/27 (33%), Positives = 15/27 (55%)
 Frame = -3

Query: 228 RGASYPAKPALHIPEPLSTTNAATSSS 148
           R  S+P  P ++IP+P  T  +  + S
Sbjct: 359 RRRSHPTNPTVNIPQPAQTVPSNDNGS 385


>SPAC30.01c |sec72|sec7b|Sec7 domain|Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1822

 Score = 23.8 bits (49), Expect = 9.7
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +1

Query: 145  VRRRSCRVGSRQWLRYVQGRLRRI*CSSRSVSLDR 249
            VRR++  +GS   +R+V G   R   S+R+ SL +
Sbjct: 1100 VRRKNVNIGSSNSIRHVSGSTSR---STRTRSLSK 1131


>SPAC3H1.06c |||membrane transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 589

 Score = 23.8 bits (49), Expect = 9.7
 Identities = 10/30 (33%), Positives = 15/30 (50%)
 Frame = -3

Query: 303 IRVLLSHTDHHALMAGLPTIEGNTARGASY 214
           + + LS  D   +   +PTI  N   G+SY
Sbjct: 98  LSIFLSALDQTVITTAIPTIVANLDGGSSY 127


>SPAC17A2.01 |bsu1|SPAC1B1.05, bsu1|high-affinity import carrier for
           pyridoxine, pyridoxal, and pyridoxamine
           Bsu1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 526

 Score = 23.8 bits (49), Expect = 9.7
 Identities = 9/23 (39%), Positives = 12/23 (52%)
 Frame = -2

Query: 391 PCHPS*WRFRVRWGI*GSGYLFC 323
           P HP  W +  RW I    ++FC
Sbjct: 69  PAHPQNWHWAKRWSI---VFMFC 88


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,703,814
Number of Sequences: 5004
Number of extensions: 35216
Number of successful extensions: 101
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 92
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 130061696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).