SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1093.04c |||tRNA nucleotidyltransferase |Schizosaccharomyces...    28   0.96 
SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces pomb...    27   2.2  
SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces ...    27   2.9  
SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2 |Sch...    26   5.1  
SPAC821.07c |moc3||transcription factor Moc3|Schizosaccharomyces...    25   6.8  
SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces pom...    25   6.8  
SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyc...    25   6.8  
SPBC27B12.04c |||conserved eukaryotic protein|Schizosaccharomyce...    25   9.0  
SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit ...    25   9.0  
SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster ...    25   9.0  
SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c...    25   9.0  

>SPAC1093.04c |||tRNA nucleotidyltransferase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 500

 Score = 28.3 bits (60), Expect = 0.96
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = -2

Query: 183 HHSYTNSHRATKTSFAKPIILTYQTIGTRTIIFVTINNK 67
           HH YTNS+ + K  F  P+    +   T   +F  + +K
Sbjct: 120 HHDYTNSNSSNKLVFGTPLEDALRRDATINALFYNLKSK 158


>SPAC56F8.12 |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 394

 Score = 27.1 bits (57), Expect = 2.2
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 1/38 (2%)
 Frame = +2

Query: 257 RSTWTEG-ELDP*TRRPQYNKFGPCGRIMKNSAMVMQI 367
           RSTW  G E D     P Y   GPC + MK     ++I
Sbjct: 347 RSTWGIGSEHDMQCLPPSYETMGPCEKEMKEETNEVEI 384


>SPBC4B4.03 |rsc1||RSC complex subunit Rsc1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 803

 Score = 26.6 bits (56), Expect = 2.9
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = -2

Query: 207 SQHFFKQSHHSYTNSHRATKTSFAKPIILT 118
           S H  + SH SY NS      +F  PI+ T
Sbjct: 579 SSHSERSSHSSYHNSSHVPTAAFNSPIMRT 608


>SPBP23A10.04 |apc2||anaphase-promoting complex subunit Apc2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 681

 Score = 25.8 bits (54), Expect = 5.1
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
 Frame = +1

Query: 166 IRVAVMA-LFKKMLRRQYSHESG--KTELVKSSEEYLDRRRTRSL 291
           + V +++ LF   L  +Y H  G  K EL   +EEY +R+R R L
Sbjct: 458 LHVTILSRLFWPTLSVRYFHLPGPLKKELDAYAEEYRERKRKREL 502


>SPAC821.07c |moc3||transcription factor Moc3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 497

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 12/42 (28%), Positives = 25/42 (59%)
 Frame = -2

Query: 204 QHFFKQSHHSYTNSHRATKTSFAKPIILTYQTIGTRTIIFVT 79
           QH + QS+H+   ++ ++ TS  KP +   Q++G  +  F++
Sbjct: 156 QHQYLQSNHNVPTNNSSSATSSTKPSV---QSVGQASYPFLS 194


>SPAC24B11.07c |||ketopantoate reductase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 561

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 271 RRRTRSLNAPSPIQQVWTMRQDYE 342
           RR  RSL +PS +Q   +++ DYE
Sbjct: 406 RRSRRSLYSPSLMQMQQSLKSDYE 429


>SPCC1672.10 |mis16||kinetochore protein Mis16 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 430

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 10/36 (27%), Positives = 19/36 (52%)
 Frame = -2

Query: 405 RLDQVSLCDAGSWICMTMAEFFIILPHGPNLLYWGR 298
           R+ + S C    W+  ++A+  I+    P+ + WGR
Sbjct: 384 RISEFSWCPNERWVVGSLADDNILQIWSPSRVIWGR 419


>SPBC27B12.04c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 817

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +1

Query: 253 SEEYLDRRRT---RSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEA 390
           S+ YL  ++      LN  +  Q+  T   DYE FRH  A   S  A++
Sbjct: 252 SQSYLQEKKAGLAEVLNISTSQQKPKTTALDYEVFRHEMATKFSSFADS 300


>SPCC16C4.14c |sfc4||transcription factor TFIIIC complex subunit
           Sfc4|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1006

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 10/35 (28%), Positives = 18/35 (51%)
 Frame = -3

Query: 119 HIKRLEHER*FLSPLIINTIAFWKLENKGFNRKIS 15
           H+K  +HE  F    +  ++ FW   +  +NR +S
Sbjct: 199 HLKPKDHELWFTCAKLSESLEFWDQADYCYNRAVS 233


>SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster
           type |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 827

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 17/69 (24%), Positives = 30/69 (43%)
 Frame = +1

Query: 283 RSLNAPSPIQQVWTMRQDYEKFRHGHANPGSGVAEADLVKPPLTVLVIKKVHDAQILAPF 462
           R+   P+P+Q+  +     +     +  P    AE +  KPPL + +        I++ F
Sbjct: 155 RNSTVPNPVQESNSSSSQPDPLSFPYLPPTP--AEDEHKKPPLKIQLPPYEEALSIVSQF 212

Query: 463 VQLVHWLVH 489
               H+LVH
Sbjct: 213 FMNDHFLVH 221


>SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 594

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 14/56 (25%), Positives = 24/56 (42%)
 Frame = -1

Query: 397 PGQPLRRRILDLHDHGGIFHNPAAWSKLVVLGTARSGI*FSFCPSTPLSS*QVPFC 230
           PG  +RR+++ + D    F  P   +K++  G       +   P  P S   +P C
Sbjct: 79  PGNRIRRQVVQILDKSWSFLAPNESAKVIDQGNYEYPFYYELPPDIPDSIEGIPGC 134


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,861,513
Number of Sequences: 5004
Number of extensions: 63164
Number of successful extensions: 205
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 200
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 205
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 277683324
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).