SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual     27   1.4  
SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce...    27   2.5  
SPBC25B2.09c |||arginine-tRNA ligase|Schizosaccharomyces pombe|c...    27   2.5  
SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces po...    26   4.3  
SPAC3C7.11c |cnx1|cal1, cal1|calnexin |Schizosaccharomyces pombe...    25   5.7  
SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit Alp4|...    25   5.7  
SPBC25B2.03 |||zf-C3HC4 type zinc finger|Schizosaccharomyces pom...    25   7.5  
SPBC1709.02c |vas2|SPBC1734.18c|valine-tRNA ligase Vas2 |Schizos...    25   10.0 

>SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 381

 Score = 27.5 bits (58), Expect = 1.4
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = +3

Query: 420 VLDVWHLWIRQRYKCVPRTRSMY 488
           VL  WHLW R+RY+     RSM+
Sbjct: 180 VLQKWHLW-RRRYELFLAKRSMF 201


>SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1610

 Score = 26.6 bits (56), Expect = 2.5
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
 Frame = +2

Query: 113 NVVDWNYPDQFSKQQALRT-GALIPENALPVGIERW-RNKLFV 235
           +++ WN P QF  +Q L     L P   L + +ER  R K+FV
Sbjct: 74  DLIQWNDPSQFDNEQFLNALAVLFPR--LSIEVERHVRLKIFV 114


>SPBC25B2.09c |||arginine-tRNA ligase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 618

 Score = 26.6 bits (56), Expect = 2.5
 Identities = 22/60 (36%), Positives = 29/60 (48%)
 Frame = +1

Query: 19  LSK*NGSEVFSFLWASLTSISNDKAPRNILVERGRLELPGPVLEAAGSQDWCSDTRERTA 198
           LSK NG +V     A  TSIS D A  N+ V R R++     L    ++ +  D  E TA
Sbjct: 44  LSKINGVDVSLIYPALETSISKDSADLNLPVPRLRVKGKPQELAQKWAEAFPKDLVEVTA 103


>SPAP14E8.04 |oma1||metallopeptidase Oma1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 337

 Score = 25.8 bits (54), Expect = 4.3
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
 Frame = -1

Query: 174 APVL--RACCFENWSG*FQSTTFHENISWS 91
           APVL  + C + N++G  Q+     N+SWS
Sbjct: 19  APVLSYKKCSYRNFNGLLQARFQSNNLSWS 48


>SPAC3C7.11c |cnx1|cal1, cal1|calnexin |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 560

 Score = 25.4 bits (53), Expect = 5.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +3

Query: 465 VPRTRSMYFDLNTDQIIP*IRCYDPEDI 548
           V R  S+++D     ++P +  YDPEDI
Sbjct: 222 VVRQGSLFYDF-IPPVLPPVEIYDPEDI 248


>SPBC365.15 |alp4||gamma tubulin complex Spc97/GCP2 subunit
           Alp4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 784

 Score = 25.4 bits (53), Expect = 5.7
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +1

Query: 34  GSEVFSFLWASLTSISNDKAPRNIL 108
           G +V SFL  SLT  + D   R IL
Sbjct: 255 GGQVISFLTESLTKYAGDPVARKIL 279


>SPBC25B2.03 |||zf-C3HC4 type zinc finger|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 554

 Score = 25.0 bits (52), Expect = 7.5
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = +1

Query: 298 YEPSPKLTPYPSFEGN 345
           Y+P+PKLTP+ SF  N
Sbjct: 221 YKPNPKLTPF-SFNNN 235


>SPBC1709.02c |vas2|SPBC1734.18c|valine-tRNA ligase Vas2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 980

 Score = 24.6 bits (51), Expect = 10.0
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)
 Frame = +3

Query: 312 EINALPEL-RRQRIRQLSNRTDYCIQGQ 392
           EI   P++ RR+ IR + N  D+CI  Q
Sbjct: 491 EIEIAPDMSRREFIRWMENIQDWCISRQ 518


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,415,103
Number of Sequences: 5004
Number of extensions: 50910
Number of successful extensions: 111
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 111
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 233995432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).