SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch...    31   0.14 
SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces...    29   0.56 
SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1 |Schi...    28   0.97 
SPAC144.09c |sfc2||RNA polymerase III transcription factor TFIII...    27   2.3  
SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb...    27   2.3  
SPCC1682.07 |ssl1||transcription factor TFIIH complex subunit Ss...    27   3.0  
SPBC15C4.03 |||Rab geranylgeranyltransferase escort protein |Sch...    26   3.9  
SPBC3D6.11c |slx8||ubiquitin-protein ligase E3 Slx8 |Schizosacch...    26   5.2  

>SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 297

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 4/48 (8%)
 Frame = +2

Query: 266 CCSYS----CTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPAS 397
           CCS      C+     CCS    TSCC      CC +    CCSN  S
Sbjct: 247 CCSSKKPSCCSQEKKGCCSTE-KTSCCSQEKKSCCTSEKPSCCSNGKS 293



 Score = 28.7 bits (61), Expect = 0.74
 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 3/73 (4%)
 Frame = +2

Query: 260 SICCSY--SCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCS-NPASGSLHSPCSCCI 430
           S CCS   S       CCS     SCC S    CC      CCS    S       SCC 
Sbjct: 223 SSCCSKKDSSPSEKPSCCSQE-KKSCCSSKKPSCCSQEKKGCCSTEKTSCCSQEKKSCCT 281

Query: 431 CCRLPIWSSTSST 469
             +    S+  ST
Sbjct: 282 SEKPSCCSNGKST 294


>SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1639

 Score = 29.1 bits (62), Expect = 0.56
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = -1

Query: 528  KALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHR 349
            K++C  +S + T   +  G   ++ DH    + +Q+   E +  +    Q+  +M+ + R
Sbjct: 948  KSVCVNNSAD-TSTNLWLGTCTDIHDHKMLEEKLQESNIEAQRIVRSKMQYLSNMSHEIR 1006

Query: 348  MPLLG-QQEVPHLLEQQ 301
             PL+G    V  LLE Q
Sbjct: 1007 TPLIGITGMVSFLLETQ 1023


>SPBC30B4.01c |wsc1|SPBC3D6.14c|transmembrane receptor Wsc1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 374

 Score = 28.3 bits (60), Expect = 0.97
 Identities = 21/66 (31%), Positives = 26/66 (39%)
 Frame = +2

Query: 269 CSYSCTLRCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCRLPI 448
           C    TL  T   S+ C T+ CP  G L C   L W      +G L +  S         
Sbjct: 79  CYCGSTLTATEVSSSLC-TTPCPGYGSLMCGGDLYWSVYLTGNGVLQTTVSSSSVSSTTS 137

Query: 449 WSSTSS 466
            SS+SS
Sbjct: 138 SSSSSS 143


>SPAC144.09c |sfc2||RNA polymerase III transcription factor
           TFIIIA|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 374

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 6/51 (11%)
 Frame = -1

Query: 534 CRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSR---QHMQQ---EQGECRE 400
           C+K+    S++++ +  IH GN+    D  G++   +HM Q   E+G C++
Sbjct: 243 CKKSFTRSSALKKHISVIHEGNMAFHCDSCGTKFGYKHMLQRHLERGTCKK 293


>SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1283

 Score = 27.1 bits (57), Expect = 2.3
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 7/47 (14%)
 Frame = -1

Query: 204  CPAG--DINLCSVWRNVLRYSLSVSHVGWSNQRSS-----GYCWNSC 85
            C AG  D++ C+ W     Y        + NQ +S      YCWN C
Sbjct: 1237 CSAGVTDMSECNTWSYQKSYDYITGCNNYDNQGNSQTDASDYCWNVC 1283


>SPCC1682.07 |ssl1||transcription factor TFIIH complex subunit
           Ssl1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 421

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 12/27 (44%), Positives = 13/27 (48%)
 Frame = +2

Query: 368 LCWCCSNPASGSLHSPCSCCICCRLPI 448
           LC C S P+ G  H P      C LPI
Sbjct: 297 LCACHSIPSRGGFHCPRCKAKVCTLPI 323


>SPBC15C4.03 |||Rab geranylgeranyltransferase escort protein
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 459

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = -1

Query: 600 PKLYFIHQYKLLSTNK-SFVLSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHM 445
           P+ Y I   K L+ +  + V +L  K LCSFS  +   + +     L  L H+
Sbjct: 372 PEGYCIWYLKTLNDSPCNEVFNLATKKLCSFSGCDDLEIIVQVDETLNQLRHI 424


>SPBC3D6.11c |slx8||ubiquitin-protein ligase E3 Slx8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 269

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 15/50 (30%), Positives = 20/50 (40%)
 Frame = +2

Query: 290 RCTFCCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCCICCR 439
           +C  C  +    SC P   I C F IL       A G+  +   C +C R
Sbjct: 205 KCVICLDSPENLSCTPCGHIFCNFCIL------SALGTTAATQKCPVCRR 248


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,028,791
Number of Sequences: 5004
Number of extensions: 39277
Number of successful extensions: 145
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 142
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 281707720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).