SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0027
         (611 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc...    27   2.8  
SPCC1753.03c |rec7||meiotic recombination protein Rec7 |Schizosa...    26   4.9  
SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||...    25   6.5  
SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr ...    25   6.5  
SPAC2C4.16c |rps801|rps8-1|40S ribosomal protein S8|Schizosaccha...    25   6.5  
SPAC521.05 |rps802|rps8-2|40S ribosomal protein S8|Schizosacchar...    25   6.5  

>SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 732

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +1

Query: 319 PPFASWRNSEEARTDRPSQQLRSLN 393
           PP AS RN  E  +  PS+Q  S+N
Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377


>SPCC1753.03c |rec7||meiotic recombination protein Rec7
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 339

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 12/42 (28%), Positives = 21/42 (50%)
 Frame = -1

Query: 221 ANWVPGPPSSRRL*TSFITEIQKKYTSKXXXXXXXXXISSLC 96
           AN +P PP++ ++  + +TE +K+  SK            LC
Sbjct: 288 ANLIPSPPTTSQILPTELTEEEKQLRSKVLFYLKQDSFIQLC 329


>SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr
            3|||Manual
          Length = 1315

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = -1

Query: 572  FFNSGLLFQTGTTLNPISGLFFDL*GILPISAY 474
            F    +L+ T + L     LF DL  ILPI+ +
Sbjct: 1082 FITVSILYTTNSNLGDFQFLFIDLVIILPIAVF 1114


>SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 774

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 490 KIPYKSKNRPEIGLSVVPVWNKSPLLKNVDSNVKGRKNR 606
           K+  ++ +RPE  L++  V+  S LLK  DSN  G +NR
Sbjct: 260 KVSVRTLSRPE-PLTIKKVY--STLLKIADSNGNGAQNR 295


>SPAC2C4.16c |rps801|rps8-1|40S ribosomal protein
           S8|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 200

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +3

Query: 36  KTRL*QKSYMKTLNM*VRTRTQRRNCLVNKDILYFR 143
           KTR+ Q +Y  + N  VRT T  ++ +V  D   FR
Sbjct: 75  KTRIIQVAYHPSNNELVRTNTLTKSAIVQIDAAPFR 110


>SPAC521.05 |rps802|rps8-2|40S ribosomal protein
           S8|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 200

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = +3

Query: 36  KTRL*QKSYMKTLNM*VRTRTQRRNCLVNKDILYFR 143
           KTR+ Q +Y  + N  VRT T  ++ +V  D   FR
Sbjct: 75  KTRIIQVAYHPSNNELVRTNTLTKSAIVQIDAAPFR 110


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,594,344
Number of Sequences: 5004
Number of extensions: 53211
Number of successful extensions: 107
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 107
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 267622334
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).