SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   182   4e-47
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...   103   2e-23
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...   101   6e-23
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    95   6e-21
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    69   4e-13
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    64   1e-11
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    53   3e-08
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    44   1e-05
SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce...    32   0.059
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    31   0.14 
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    28   0.97 
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    27   2.2  
SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    27   2.2  
SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual         27   2.2  
SPAC328.05 |||RNA-binding protein involved in export of mRNAs|Sc...    27   3.0  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    27   3.0  
SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces p...    26   3.9  
SPCC965.04c |||mitochondrial inner membrane i-AAA protease compl...    26   3.9  
SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual    26   5.2  
SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces ...    25   6.8  
SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosa...    25   9.0  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  182 bits (443), Expect = 4e-47
 Identities = 86/112 (76%), Positives = 91/112 (81%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPK+NREKMT
Sbjct: 61  KRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREKMT 120

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QI+FETFN PA YVAIQAVLSLYASG        S    +   P  +GYALP
Sbjct: 121 QIIFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALP 172



 Score =  124 bits (300), Expect = 8e-30
 Identities = 55/60 (91%), Positives = 59/60 (98%)
 Frame = +1

Query: 76  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 255
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score =  103 bits (248), Expect = 2e-23
 Identities = 43/86 (50%), Positives = 65/86 (75%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ 434
           R +L +KYP+E+GI+ ++++M ++W +TF+ +L++ P    +LLTE P+NP ANREKM +
Sbjct: 62  RSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCE 121

Query: 435 IMFETFNTPAMYVAIQAVLSLYASGV 512
            MFE +    +YVAIQAVLSLYA G+
Sbjct: 122 TMFERYGFGGVYVAIQAVLSLYAQGL 147



 Score = 54.4 bits (125), Expect = 1e-08
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = +1

Query: 82  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQS 252
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VGDEA++
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEA 60



 Score = 34.3 bits (75), Expect = 0.015
 Identities = 12/22 (54%), Positives = 18/22 (81%)
 Frame = +2

Query: 512 TTGIVLDFGDGVFHTVPIYERI 577
           ++G+V+D GDGV H VP+YE +
Sbjct: 148 SSGVVVDSGDGVTHIVPVYESV 169


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score =  101 bits (243), Expect = 6e-23
 Identities = 47/94 (50%), Positives = 61/94 (64%)
 Frame = +3

Query: 267 TLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 446
           +L YPI HG + NWD ME+ W  + +  LR  PE+H  LLTE PLNP  NRE   +IMFE
Sbjct: 89  SLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFE 148

Query: 447 TFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVS 548
           +FN   +Y+A+QAVL+L AS       WTS+ V+
Sbjct: 149 SFNCAGLYIAVQAVLALAAS-------WTSSKVT 175



 Score = 42.7 bits (96), Expect = 4e-05
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKDSYVGDE 243
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G  +  K SY+  +
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIA-TRSAGASSGPAVSSKPSYMASK 58



 Score = 30.3 bits (65), Expect = 0.24
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +2

Query: 506 RRTTGIVLDFGDGVFHTVPIYE 571
           R  TG V+D GDGV H +P+ E
Sbjct: 177 RSLTGTVVDSGDGVTHIIPVAE 198


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 95.5 bits (227), Expect = 6e-21
 Identities = 42/85 (49%), Positives = 60/85 (70%), Gaps = 1/85 (1%)
 Frame = +3

Query: 255 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMT 431
           RG+L ++ PIE GI+ NW DME+IW + + ++ L   PEEHP+LLTE PL    N+EK+ 
Sbjct: 66  RGLLKIQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNKEKIA 125

Query: 432 QIMFETFNTPAMYVAIQAVLSLYAS 506
           +  +ET N PA+  ++Q VL+LYAS
Sbjct: 126 EYFYETLNVPALSFSLQPVLALYAS 150



 Score = 69.7 bits (163), Expect = 3e-13
 Identities = 30/53 (56%), Positives = 39/53 (73%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG EAQ+
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQN 64



 Score = 37.5 bits (83), Expect = 0.002
 Identities = 15/21 (71%), Positives = 19/21 (90%)
 Frame = +2

Query: 509 RTTGIVLDFGDGVFHTVPIYE 571
           RTTGIVL+ GDG+ H+VPIY+
Sbjct: 152 RTTGIVLECGDGLTHSVPIYD 172


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 69.3 bits (162), Expect = 4e-13
 Identities = 32/82 (39%), Positives = 46/82 (56%)
 Frame = +3

Query: 264 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF 443
           + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + MF
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLETMF 122

Query: 444 ETFNTPAMYVAIQAVLSLYASG 509
           E+   PA Y+A Q   + +ASG
Sbjct: 123 ESLRCPATYLAKQETCAAFASG 144



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 180
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 64.5 bits (150), Expect = 1e-11
 Identities = 29/82 (35%), Positives = 47/82 (57%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 458
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE +N 
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFELYNA 144

Query: 459 PAMYVAIQAVLSLYASGVPPVS 524
           P++   I  + S Y +  P  S
Sbjct: 145 PSVAYGIDGLFSFYHNTKPSSS 166



 Score = 35.9 bits (79), Expect = 0.005
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 94  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 189
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 53.2 bits (122), Expect = 3e-08
 Identities = 22/73 (30%), Positives = 42/73 (57%)
 Frame = +3

Query: 288 HGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 467
           +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ +  FE  + PA 
Sbjct: 74  NGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFEQLHVPAF 133

Query: 468 YVAIQAVLSLYAS 506
           Y+  QAV   +A+
Sbjct: 134 YLTKQAVCVAFAN 146



 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 79  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQ 58


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 44.4 bits (100), Expect = 1e-05
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 4/82 (4%)
 Frame = +3

Query: 279 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMTQIMFE 446
           PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  TQ  FE
Sbjct: 113 PIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELATQFFFE 171

Query: 447 TFNTPAMYVAIQAVLSLYASGV 512
               P   +A + ++ LYA G+
Sbjct: 172 ECQVPGFTIAYEPLMGLYAIGI 193


>SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1666

 Score = 32.3 bits (70), Expect = 0.059
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +3

Query: 339  FYNELRVAPEEHPVLLTE--APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGV 512
            +Y  L    E+HP+LLT+  A L P+ +  ++ +I  ++ NTP +   + A+  L    V
Sbjct: 1399 YYRALNFYLEQHPMLLTDLLAALTPRIDHPRVIRIFEKSENTPLILNFMVAIQHLNIQAV 1458


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 31.1 bits (67), Expect = 0.14
 Identities = 23/67 (34%), Positives = 28/67 (41%), Gaps = 5/67 (7%)
 Frame = -2

Query: 260 TSLLCASS----PT*ESFCPI-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTT 96
           TS  C +S    PT  S  P+ PT+ P     P    N     S P         PL+TT
Sbjct: 389 TSTSCTTSTSIPPTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATT 448

Query: 95  NAATSSS 75
           N  TS+S
Sbjct: 449 NCTTSTS 455


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 28.3 bits (60), Expect = 0.97
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -3

Query: 247 VPHLLHKSPSVPYRPSRPDGGAFPRSRGTR 158
           +  L+ K+PS PY  SRP   A   S  TR
Sbjct: 306 IDQLISKAPSYPYSSSRPSASASLASSPTR 335


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1517

 Score = 27.1 bits (57), Expect = 2.2
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +1

Query: 139 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 252
           G+  PRA F  ++  P H G+++ M  KD   G+E  S
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEEFMS 537


>SPBC582.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 601

 Score = 27.1 bits (57), Expect = 2.2
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -3

Query: 577 YPFVNGHGVEDTVAEVQHDTGGTPDA-YSESTAWMATYMAGVLNVSNMIWVIF 422
           +  +N  GV+DT+  + +   G P   Y EST + A  +    N++ + W ++
Sbjct: 395 FEVMNCKGVQDTLTAIWNTNSGKPSGWYLESTMYKALDVT-YYNLNTLSWNLY 446


>SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 127

 Score = 27.1 bits (57), Expect = 2.2
 Identities = 23/58 (39%), Positives = 27/58 (46%)
 Frame = -1

Query: 270 GSGYLFALCLISYIRVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAHTGAIVYY 97
           G G  F  CLI++IR  +SH            D  EHG   II C T L   G I+YY
Sbjct: 49  GLGIAFIYCLIAFIRE-MSHPSSR-------KDTMEHGL-PIILCST-LMLVGNILYY 96


>SPAC328.05 |||RNA-binding protein involved in export of
           mRNAs|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = -3

Query: 292 PCSMGYLRVRIPLCSVPHLLHKSPSVPYRP 203
           P  + Y     PL +VP +L   PSV Y P
Sbjct: 349 PLQLSYAHYATPLPAVPTVLSGLPSVAYTP 378


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.6 bits (56), Expect = 3.0
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -2

Query: 239 SPT*ESFC--PIPTITP*WRGLPTIEGNTARGASSPAKPAL 123
           S T +SF   P+PT  P    LPT   NT +    P+ PAL
Sbjct: 64  SNTPKSFAAPPVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 226

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +3

Query: 381 LLTEAPLNPKANREKMTQIMFETFN 455
           +L  APL+ +   +KM +++FET+N
Sbjct: 181 VLETAPLHAEEVSKKMKELLFETYN 205


>SPCC965.04c |||mitochondrial inner membrane i-AAA protease complex
           subunit Yme1 |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 709

 Score = 26.2 bits (55), Expect = 3.9
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +3

Query: 498 YASGVPPVSCWTSATVSSTP 557
           +++GVP  +  TS+TVSSTP
Sbjct: 145 FSAGVPKFTSDTSSTVSSTP 164


>SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1828

 Score = 25.8 bits (54), Expect = 5.2
 Identities = 12/23 (52%), Positives = 14/23 (60%)
 Frame = -3

Query: 121 TYRSHCLLPTRQLLRRTS*ISEI 53
           TYR H  +PT  LL  T  +SEI
Sbjct: 168 TYRDHDAIPTATLLNPTLDVSEI 190


>SPCC1795.10c |||Sed5 Vesicle Protein Svp26 |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 227

 Score = 25.4 bits (53), Expect = 6.8
 Identities = 17/64 (26%), Positives = 30/64 (46%)
 Frame = -3

Query: 571 FVNGHGVEDTVAEVQHDTGGTPDAYSESTAWMATYMAGVLNVSNMIWVIFSLLALGLRGA 392
           FV+    ++T+  +   +  +PDAYS  ++   + +         I+V  SL +LGL   
Sbjct: 162 FVSFTAADNTLPTITTPSSSSPDAYSSGSSRRTSNVLRQAYKKLGIFVERSLTSLGLSDR 221

Query: 391 SVSR 380
           S  R
Sbjct: 222 SSER 225


>SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2
            |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1628

 Score = 25.0 bits (52), Expect = 9.0
 Identities = 13/39 (33%), Positives = 24/39 (61%)
 Frame = +2

Query: 395  SPQPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRVRR 511
            +PQ +    E++ D++R++  +RH RR P +A  +  RR
Sbjct: 1428 TPQSRSFTNENN-DNLRSV--SRHTRREPQQAQNLNARR 1463


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,955,527
Number of Sequences: 5004
Number of extensions: 66676
Number of successful extensions: 210
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 186
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 206
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 279695522
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).