SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces p...    28   0.88 
SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccha...    26   3.5  
SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22...    25   8.2  
SPBC3H7.15 |hhp1||serine/threonine protein kinase Hhp1|Schizosac...    25   8.2  
SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual      25   8.2  
SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr ...    25   8.2  
SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein Pop2|Schizosacchar...    25   8.2  
SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||...    25   8.2  

>SPBC21C3.20c |git1||C2 domain protein Git1|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1098

 Score = 28.3 bits (60), Expect = 0.88
 Identities = 15/59 (25%), Positives = 26/59 (44%)
 Frame = +3

Query: 84   LPINYEE*LLVRVYFDVVYRVHNN*TIWKPFNFEEADEKKNCRRRLDLEYYQKSDCRRI 260
            +P+N  E  +V  +  + Y    N     PF+F   DE K+     D  + +  D +R+
Sbjct: 1038 IPLNKRELKMVYSWLQLFYDFFRNFQDIAPFDFLNTDEYKSVMAIKDYYFVKSKDVKRV 1096


>SPBC776.09 |ste13||ATP-dependent RNA helicase
           Ste13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 485

 Score = 26.2 bits (55), Expect = 3.5
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 2/39 (5%)
 Frame = -1

Query: 219 IVFCNFSSRPLLQS*KVSRLFNCC--AHGKRHQNKREQV 109
           I+FCN ++R  L + K++ L   C  +H K  Q+ R +V
Sbjct: 285 IIFCNSTNRVELLAKKITELGYSCFYSHAKMLQSHRNRV 323


>SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase
           Snf22|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1680

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%)
 Frame = +3

Query: 261 MPNSEGTNATQAVFPVRSTPSASTMVSSQPLIMAEG-TASPNVTLTPQDLIYKKCL 425
           +PN     A  A  PV++   A   VS  PL  + G T        P ++ Y  C+
Sbjct: 512 IPNQFQRRAYSATIPVKNESLAKPSVSPMPLQQSTGKTEVAKRAQFPTNVNYSSCV 567


>SPBC3H7.15 |hhp1||serine/threonine protein kinase
           Hhp1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 365

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 4/67 (5%)
 Frame = +3

Query: 324 ASTMVSSQPLIMAEGTASPNVTLT---PQDL-IYKKCLSELETLVMPDYRQNNRPYSDVR 491
           A+T       IM +  ++P   L    PQ+  IY      L     PDY    + + D+ 
Sbjct: 220 ATTKKQKYEKIMEKKISTPTEVLCRGFPQEFSIYLNYTRSLRFDDKPDYAYLRKLFRDLF 279

Query: 492 CRENYCF 512
           CR++Y F
Sbjct: 280 CRQSYEF 286


>SPAC17H9.01 |cid16||poly|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1202

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +3

Query: 381 NVTLTPQDLIYKKCLSELETLVMPDYRQNNRPYSDVRCRENYCFAE 518
           ++T T Q +  +K L++L   ++P Y Q+N    D+      CF+E
Sbjct: 431 SITSTLQAIGTRKILTQLSINMIPRYNQDNCSAGDIYI---LCFSE 473


>SPAC2F3.11 |||exopolyphosphatase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 384

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 2/78 (2%)
 Frame = +3

Query: 321 SASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCL--SELETLVMPDYRQNNRPYSDVRC 494
           +AST+ S+       G  S ++      ++Y  CL   +L  +V+P +   N P  ++R 
Sbjct: 20  NASTVSSAPSFSFVSGNESADLDSCASSIVYAYCLQRKQLGRIVVPFF---NIPRKELRL 76

Query: 495 RENYCFAEATNTSAISGE 548
           R    +    N ++IS +
Sbjct: 77  RPELSY--LLNLASISSD 92


>SPAC4D7.03 |pop2|sud1|F-box/WD repeat protein
           Pop2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 703

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 24/87 (27%), Positives = 42/87 (48%)
 Frame = +3

Query: 321 SASTMVSSQPLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMPDYRQNNRPYSDVRCRE 500
           S+S + SS PLI +   A+P  +  PQ  ++   L   + L +P   Q+++  SD R   
Sbjct: 11  SSSRINSSVPLINSSSPATPPESFDPQ--VFPSSLIHGDNL-LP---QDDQIASDPRSES 64

Query: 501 NYCFAEATNTSAISGERMRIQSFQHPL 581
           N C    +++   +       S+Q+PL
Sbjct: 65  NSCNGNTSSSLPCT------DSYQYPL 85


>SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1367

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 17/69 (24%), Positives = 29/69 (42%), Gaps = 3/69 (4%)
 Frame = -3

Query: 394  VSVTFGDAVPSAIIKGWLETIVDALGVERTGNTACVAFVPSEF---GIILLQSDFW*YSR 224
            V++  GD      +    +  V   GVE    +    +   +F   G +LL    W Y R
Sbjct: 1029 VTLAIGDGANDVSMIQEADVGVGIKGVEGQAASMSADYAIGQFSFLGRLLLVHGRWDYKR 1088

Query: 223  SNRLLQFFF 197
             ++++ FFF
Sbjct: 1089 MSQMISFFF 1097


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,405,647
Number of Sequences: 5004
Number of extensions: 50710
Number of successful extensions: 155
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 151
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 155
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 254167452
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).