SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23C11.02c |rps23||40S ribosomal protein S23|Schizosaccharomy...    87   1e-18
SPBP4H10.13 |rps2302|rps23-2|40S ribosomal protein S23|Schizosac...    87   1e-18
SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizo...    37   0.002
SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc...    27   1.7  
SPCC550.08 |||N-acetyltransferase |Schizosaccharomyces pombe|chr...    25   5.3  
SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual        25   9.3  
SPBC56F2.12 |ilv5||acetohydroxyacid reductoisomerase|Schizosacch...    25   9.3  

>SPAC23C11.02c |rps23||40S ribosomal protein S23|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 143

 Score = 87.4 bits (207), Expect = 1e-18
 Identities = 39/48 (81%), Positives = 44/48 (91%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  +EK+GVEAKQPNSAIRKCVRVQLIKNGKKVTAFVP DGCLN +++
Sbjct: 49  GIVVEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPHDGCLNFVDE 96



 Score = 78.2 bits (184), Expect = 7e-16
 Identities = 36/48 (75%), Positives = 42/48 (87%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL++GFGRKG A GDIPGVRFKVVKVA V L AL+ EKKE+PR+
Sbjct: 96  ENDEVLLSGFGRKGKAKGDIPGVRFKVVKVAGVGLSALFHEKKEKPRA 143


>SPBP4H10.13 |rps2302|rps23-2|40S ribosomal protein
           S23|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 143

 Score = 87.4 bits (207), Expect = 1e-18
 Identities = 39/48 (81%), Positives = 44/48 (91%)
 Frame = -2

Query: 395 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCLNHIEK 252
           G  +EK+GVEAKQPNSAIRKCVRVQLIKNGKKVTAFVP DGCLN +++
Sbjct: 49  GIVVEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPHDGCLNFVDE 96



 Score = 78.2 bits (184), Expect = 7e-16
 Identities = 36/48 (75%), Positives = 42/48 (87%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 112
           +NDEVL++GFGRKG A GDIPGVRFKVVKVA V L AL+ EKKE+PR+
Sbjct: 96  ENDEVLLSGFGRKGKAKGDIPGVRFKVVKVAGVGLSALFHEKKEKPRA 143


>SPAC4F8.06 |||mitochondrial ribosomal protein subunit
           S12|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 146

 Score = 36.7 bits (81), Expect = 0.002
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = -2

Query: 371 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 273
           V+ K+PNSA+RK  RV+L   G+ VTA++P  G
Sbjct: 61  VKPKKPNSAVRKVARVRL-STGRSVTAYIPGIG 92


>SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit
           Apc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1458

 Score = 27.1 bits (57), Expect = 1.7
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = +1

Query: 178 LKTNSGNVTDGVTFTTESRH*YFVVFSMWFRQPSR 282
           +K  +  VTD     T+S H Y VV  M FR+  R
Sbjct: 670 IKALTSTVTDSTLVDTQSFHPYKVVTDMIFREDRR 704


>SPCC550.08 |||N-acetyltransferase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 247

 Score = 25.4 bits (53), Expect = 5.3
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +1

Query: 115 SWSLLFLFVESEERHVGYFYHLKTNSGNVTD--GVTFTTESRH 237
           SW L+++ V S+E+  GY   L     N+ D  G+    ES H
Sbjct: 129 SWYLVYVGVSSKEQGKGYLRKLIEPIFNICDQEGLPIYLESSH 171


>SPBC557.05 |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 433

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 12/53 (22%), Positives = 22/53 (41%)
 Frame = -1

Query: 531 PSWPEKGDVLQRRLSWGNARVFPVTTVVKRRPVNCNTTHYRANWDRAPPRESW 373
           PSW  +  +    LS  N+ V      +++  + CN      NW+     E++
Sbjct: 275 PSWKTQQMMSHLNLSRKNSEVSKTCKCLQKETIRCNKKSNCYNWNGIAALETY 327


>SPBC56F2.12 |ilv5||acetohydroxyacid
           reductoisomerase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 404

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -1

Query: 255 KNDEVLVAGFGRKGHAVG 202
           KND + + G+G +GH  G
Sbjct: 83  KNDTLAIIGYGSQGHGQG 100


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,148,262
Number of Sequences: 5004
Number of extensions: 43680
Number of successful extensions: 84
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 81
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 84
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 218398248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).