SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces pombe...    34   0.009
SPBC2F12.05c |||sterol binding ankyrin repeat protein|Schizosacc...    31   0.084
SPAPB1A11.04c |||transcription factor |Schizosaccharomyces pombe...    29   0.19 
SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat protei...    27   1.4  
SPBC2D10.05 |exg3||glucan 1,3-beta-glucosidase Exg3|Schizosaccha...    25   3.2  
SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2 |Schizo...    25   5.5  
SPAC25B8.04c |||mitochondrial splicing suppressor |Schizosacchar...    24   7.3  
SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schiz...    24   9.7  

>SPBC1289.04c |pob1||Boi family protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 871

 Score = 33.9 bits (74), Expect = 0.009
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = -3

Query: 280 ERRREQNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDL 122
           E  +  +  G + KR      WK R+FVL   +  L YY ++ D+  KG ID+
Sbjct: 694 EAIKTADCHGWMRKRSDRYGVWKSRYFVLKGTR--LSYYHSLNDASEKGLIDM 744


>SPBC2F12.05c |||sterol binding ankyrin repeat
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1310

 Score = 30.7 bits (66), Expect = 0.084
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
 Frame = -3

Query: 265 QNARGHLYKRGALLKGWKQRWFVLDSIKHQLRYYDAMED--SHCKGFIDL 122
           Q+  G+L K      G+K RWF L++    L YY   +D  S C+G I+L
Sbjct: 255 QHMSGYLKKWTNYKSGYKLRWFTLNN--GVLSYYKNQDDASSACRGSINL 302


>SPAPB1A11.04c |||transcription factor |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 697

 Score = 29.5 bits (63), Expect = 0.19
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -1

Query: 243 TSEALYSRDGNKDGSCWTR*NISYDTTMRWKTRTVKD 133
           T+ + YS  G   G+C+T  ++ Y TT+ +  R V D
Sbjct: 411 TNYSAYSSPGESAGACYTFMHLLYHTTLTYLLRNVLD 447


>SPAC23H4.01c ||SPAP27G11.01|sterol binding ankyrin repeat
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 945

 Score = 26.6 bits (56), Expect = 1.4
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = -3

Query: 247 LYKRGALLKGWKQRWFVLDSIKHQLRYYDAMEDSHCKGFIDLA-EVIAVTQAT 92
           L KR    +G+ +R+F L+ ++  + YY     S  +G I L+  VI+V   T
Sbjct: 157 LKKRRKKGQGYARRYFTLNMVEGTISYYANENSSVMRGKIPLSIAVISVAAET 209


>SPBC2D10.05 |exg3||glucan 1,3-beta-glucosidase
           Exg3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 464

 Score = 25.4 bits (53), Expect = 3.2
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = -3

Query: 268 EQNARGHLYKRGALLKGWKQRW 203
           +Q    H Y+    +KGW Q W
Sbjct: 385 DQKQHDHPYEHDLYVKGWNQAW 406


>SPBP19A11.06 |lid2|SPBP4H10.01|Lid2 complex subunit Lid2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1513

 Score = 24.6 bits (51), Expect = 5.5
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -2

Query: 194 GLDKTSATILRCDG 153
           GLDK   TIL CDG
Sbjct: 275 GLDKNPETILLCDG 288


>SPAC25B8.04c |||mitochondrial splicing suppressor
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 378

 Score = 24.2 bits (50), Expect = 7.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = +3

Query: 183 FIESNTNHLCFHPLSRAP 236
           F + +  H  FHPLSR+P
Sbjct: 8   FKKKSPTHELFHPLSRSP 25


>SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 603

 Score = 23.8 bits (49), Expect = 9.7
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +3

Query: 36  VRKSKNDLSSHFLGGPGAGVACVTAITSAKSMNPLQCESSI 158
           + K   +L+++F+G P A V      T+A   + L C  S+
Sbjct: 234 LHKEVEELTANFVGKPAALVFSQGFSTNATVFSTLMCPGSL 274


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,322,376
Number of Sequences: 5004
Number of extensions: 23070
Number of successful extensions: 74
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 72
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 73
length of database: 2,362,478
effective HSP length: 66
effective length of database: 2,032,214
effective search space used: 130061696
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).