SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   231   4e-62
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...   122   2e-29
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...   106   2e-24
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    86   2e-18
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    70   2e-13
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    64   9e-12
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    58   6e-10
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    30   0.22 
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    28   0.69 
SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|...    27   1.2  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    27   2.1  
SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po...    26   3.7  
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    26   3.7  
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    26   3.7  
SPAP27G11.03 |||D123 family|Schizosaccharomyces pombe|chr 1|||Ma...    25   4.8  
SPAC343.10 |met11|mthfr2|methylenetetrahydrofolate reductase Met...    25   6.4  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  231 bits (565), Expect = 4e-62
 Identities = 102/113 (90%), Positives = 108/113 (95%)
 Frame = +2

Query: 89  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSK 268
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVGD  +SK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           RGILTLKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPK+
Sbjct: 62  RGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKS 114


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score =  122 bits (295), Expect = 2e-29
 Identities = 54/104 (51%), Positives = 74/104 (71%), Gaps = 1/104 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG   ++ RG+L +
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQNLRGLLKI 71

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYN-ELRVAPEEHPVLLTEAPL 415
           + PIE GI+ NW DME+IW + + + +L   PEEHP+LLTE PL
Sbjct: 72  QRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPL 115


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score =  106 bits (254), Expect = 2e-24
 Identities = 49/113 (43%), Positives = 76/113 (67%), Gaps = 2/113 (1%)
 Frame = +2

Query: 95  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDGHKSK 268
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VGD  ++ 
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAV 61

Query: 269 RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           R +L +KYP+E+GI+ ++++M ++W +TF+ +L++ P    +LLTE P+NP A
Sbjct: 62  RSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVA 114


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 86.2 bits (204), Expect = 2e-18
 Identities = 51/129 (39%), Positives = 68/129 (52%), Gaps = 24/129 (18%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKDSYV---GDGH-KSK 268
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G  +  K SY+   G GH  SK
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIAT-RSAGASSGPAVSSKPSYMASKGSGHLSSK 66

Query: 269 RGI------------------LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV 394
           R                     +L YPI HG + NWD ME+ W  + +  LR  PE+H  
Sbjct: 67  RATEDLDFFIGNDALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYF 126

Query: 395 LLTEAPLNP 421
           LLTE PLNP
Sbjct: 127 LLTEPPLNP 135


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 70.1 bits (164), Expect = 2e-13
 Identities = 39/110 (35%), Positives = 60/110 (54%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           +EV+A+V+D GS   + GF+G+D P+ V PS  G       + G    + Y+   +KS  
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFG----EEYI---YKSNP 61

Query: 272 GILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
           G + +K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP
Sbjct: 62  G-MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNP 110


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 64.5 bits (150), Expect = 9e-12
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           LV+DNGS   +AG+ G+  P+ VF ++V R R +     + +  + VG+    + G  ++
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYRDR----KLSRTSTLVGNDTLIEVGSRSI 82

Query: 287 -KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNP 421
            + P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP
Sbjct: 83  ARSPFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANP 127


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 58.4 bits (135), Expect = 6e-10
 Identities = 32/118 (27%), Positives = 64/118 (54%), Gaps = 2/118 (1%)
 Frame = +2

Query: 92  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKR 271
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV D  +   
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQIHA 61

Query: 272 GI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKALQRR 439
            I  + +K    +GI+ +W+     W      +L+V P E+ +++TE   NP++++++
Sbjct: 62  PIPGMEVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQ 119


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 29.9 bits (64), Expect = 0.22
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
 Frame = -2

Query: 249 PT*ESFCPI-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 88
           PT  S  P+ PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 401 PTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1517

 Score = 28.3 bits (60), Expect = 0.69
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +2

Query: 152 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTLKYP 295
           G+  PRA F  ++  P H G+++ M  KD   G+   S +G  + + P
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEEFMSPKGFKSPRTP 547


>SPAC24B11.12c |||P-type ATPase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1402

 Score = 27.5 bits (58), Expect = 1.2
 Identities = 12/35 (34%), Positives = 14/35 (40%)
 Frame = +1

Query: 388 PRPAY*GSPQPQGPTEEKMTPDSWFENNSTRPAMY 492
           PR  Y G P P    ++      WF  N  R A Y
Sbjct: 61  PRTLYFGLPLPDSELDDTGEAKRWFPRNKIRTAKY 95


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.6 bits (56), Expect = 2.1
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -2

Query: 252 SPT*ESFC--PIPTITP*WRGLPTIEGNTARGASSPAKPAL 136
           S T +SF   P+PT  P    LPT   NT +    P+ PAL
Sbjct: 64  SNTPKSFAAPPVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 401

 Score = 25.8 bits (54), Expect = 3.7
 Identities = 28/131 (21%), Positives = 51/131 (38%), Gaps = 2/131 (1%)
 Frame = +2

Query: 107 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHKSKRGILTL 286
           +V+DNG+   KAGFAG        P+ + R +  G  + +G + +   D        L  
Sbjct: 8   IVLDNGAYHIKAGFAGGKV--VEIPNCLTRSK-DGNRLFLGNELANCND-----FTTLQF 59

Query: 287 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPE--EHPVLLTEAPLNPKALQRRR*PQIHG 460
           +   E G + +W     +W     N   + P   ++ +LLT+      +++      +  
Sbjct: 60  RRAHEKGYLVHWSTETAVWDLVMRNVGVMEPSMADYSLLLTQPVFTMPSIEHNTIQLVFE 119

Query: 461 SKTIQHAPPCT 493
                   PCT
Sbjct: 120 EFQFDAYLPCT 130


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 25.8 bits (54), Expect = 3.7
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = -3

Query: 251 LLHKSPSVPYRPSRPDGGAFPRSRET 174
           L+ K+PS PY  SRP   A   S  T
Sbjct: 309 LISKAPSYPYSSSRPSASASLASSPT 334


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 25.8 bits (54), Expect = 3.7
 Identities = 7/21 (33%), Positives = 13/21 (61%)
 Frame = +2

Query: 293 PIEHGIVTNWDDMEKIWHHTF 355
           PI+ G V +W+ ++  W H +
Sbjct: 113 PIQRGRVVDWEALKAFWKHLY 133


>SPAP27G11.03 |||D123 family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 319

 Score = 25.4 bits (53), Expect = 4.8
 Identities = 10/44 (22%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
 Frame = +2

Query: 257 HKSKRGILTLK--YPIEHGIVTNWDDMEKIWHHTFYNELRVAPE 382
           HK +  ++ +   YP   G++ +W ++E +       E+R+ P+
Sbjct: 231 HKDRAWLIDINPFYPRTDGLLFSWSELESMNSENMKPEIRLIPK 274


>SPAC343.10 |met11|mthfr2|methylenetetrahydrofolate reductase
           Met11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 641

 Score = 25.0 bits (52), Expect = 6.4
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = +1

Query: 235 GLLCRRWAQEQKRYPDPQIPHRTRNR 312
           GLL +RW Q +    D ++   TR R
Sbjct: 305 GLLTKRWKQVESEMEDEKLLRTTRKR 330


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,239,768
Number of Sequences: 5004
Number of extensions: 50572
Number of successful extensions: 150
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 143
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 198176188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).