SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0017
         (477 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor eIF...    27   1.9  
SPBC18A7.02c |||seven transmembrane receptor-like protein|Schizo...    27   1.9  

>SPAC4A8.16c |tif33|SPAC823.01c|translation initiation factor
           eIF3c|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 918

 Score = 26.6 bits (56), Expect = 1.9
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +3

Query: 84  FHENIRVNLLKCCYVSCYSFSLQLTQVFQSSSFSYNTK 197
           FH +I + LL+C Y++C S  +++  +  +SS + +++
Sbjct: 681 FHMHINLELLECVYLTC-SMLMEIPAMAAASSTASDSR 717


>SPBC18A7.02c |||seven transmembrane receptor-like
           protein|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 457

 Score = 26.6 bits (56), Expect = 1.9
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +3

Query: 345 LLIVFWSQCRGVEAHRNSTKMSYVCPPSFIRLGHSC 452
           +LI  W + R + A R+  + +Y+C    +   H C
Sbjct: 64  VLIFNWKEIRKLGAFRSDDQFTYICDYDAVYTDHLC 99


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,865,585
Number of Sequences: 5004
Number of extensions: 35327
Number of successful extensions: 60
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 60
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 60
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 184476110
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).