SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizos...    29   0.43 
SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa...    27   2.3  
SPAC4F10.11 |spn1||septin Spn1|Schizosaccharomyces pombe|chr 1||...    26   3.0  
SPAC11H11.05c |fta6|sma6|Sim4 and Mal2 associated |Schizosacchar...    25   5.3  
SPAC688.08 |srb8|med12|mediator complex subunit Srb8 |Schizosacc...    25   7.0  
SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyce...    25   7.0  
SPAC17G6.15c |||MTC tricarboxylate transporter|Schizosaccharomyc...    25   9.3  
SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb...    25   9.3  

>SPAC144.15c |cog1||Golgi transport complex subunit Cog1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 701

 Score = 29.1 bits (62), Expect = 0.43
 Identities = 12/43 (27%), Positives = 23/43 (53%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQN 369
           S+  Y+NK++E  +   + PP     P   Q+  ++ + +KQN
Sbjct: 366 SLGLYVNKIKEKLQICFEIPPTNSFDPWSFQLKQQVLNELKQN 408


>SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 889

 Score = 26.6 bits (56), Expect = 2.3
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -1

Query: 175 NTGIHCFSRFQSLQCFSKNDALLY*NKELRMTLPN 71
           +T I CFSRFQS Q +   D   + N+ L   L N
Sbjct: 183 STNISCFSRFQSEQPYGPKDIYCW-NRFLITELDN 216


>SPAC4F10.11 |spn1||septin Spn1|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 469

 Score = 26.2 bits (55), Expect = 3.0
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +1

Query: 328 AQVVSELASTIKQNAFQLSTDHRELHATVSK 420
           +Q V E    +KQ+  +L T HRE+ A + K
Sbjct: 409 SQKVQEKEDRLKQSENELRTRHREMKAALEK 439


>SPAC11H11.05c |fta6|sma6|Sim4 and Mal2 associated
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 59

 Score = 25.4 bits (53), Expect = 5.3
 Identities = 11/42 (26%), Positives = 26/42 (61%)
 Frame = +1

Query: 241 SIARYINKVEELRREIAQQPPNTPLTPEQAQVVSELASTIKQ 366
           ++  + +++EEL  + A+    T L  E A  ++++AST+++
Sbjct: 10  AVETFKSRLEELLMQSAKVQKQTMLRKELASSMNDMASTVQE 51


>SPAC688.08 |srb8|med12|mediator complex subunit Srb8
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1233

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 8/17 (47%), Positives = 13/17 (76%)
 Frame = +3

Query: 48  EYTYLFKIFGKVIRSSL 98
           +YTYL K+FG+++   L
Sbjct: 235 DYTYLLKLFGRLLAEEL 251


>SPAC26H5.05 |||IPT/TIG ankyrin repeat protein|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1151

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = +1

Query: 304  NTPLTPEQAQVVSELASTIKQ 366
            +T LTPE+ + + E A T+K+
Sbjct: 1090 STALTPEETRAIQEQAKTLKK 1110


>SPAC17G6.15c |||MTC tricarboxylate transporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 325

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -1

Query: 100 NKELRMTLPNILKRYVYS 47
           NK  ++TLP + K Y+Y+
Sbjct: 133 NKSTQLTLPQMTKSYIYA 150


>SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 2386

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 8/22 (36%), Positives = 15/22 (68%)
 Frame = +3

Query: 408 YSVKEWASL*IGISWPDYAAVA 473
           Y++K W SL +    P+Y+++A
Sbjct: 934 YAIKAWFSLILATKEPEYSSIA 955


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,329,835
Number of Sequences: 5004
Number of extensions: 48943
Number of successful extensions: 118
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 117
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 218398248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).