SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa...    26   5.5  
SPCPB1C11.01 |amt1||ammonium transporter Amt1|Schizosaccharomyce...    26   5.5  
SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr...    25   7.3  
SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces ...    25   9.6  

>SPAC2G11.13 |atg22||autophagy associated protein Atg22
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 529

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +3

Query: 411 MFYRS*KNSFHSPEIRIAIFNYGLFIIKRSLIGLSTIQTAL 533
           + Y S K S+HS +  ++I +  LF+  R  I    IQT+L
Sbjct: 308 LLYNSVKESYHSFKHAMSISSIRLFLFSRLFINCG-IQTSL 347


>SPCPB1C11.01 |amt1||ammonium transporter Amt1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 497

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = +3

Query: 462 AIFNYGLF-IIKRSLIGLSTIQTALFCIEQMEVAGILGALAQGWGA 596
           ++ N+GL   + R   G S++   LFC+ Q   A I  ALA G  A
Sbjct: 100 SLANFGLRQTLGRPSSGASSVPDILFCVFQGMFAAITPALAIGAAA 145


>SPCC965.13 |||membrane transporter|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 537

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = +1

Query: 328 PSIVGSSYVLISLHQFVFMYEKLHLSIICFTALKKT 435
           PS+ GS+    +L  F      +HL II F  +  T
Sbjct: 450 PSVAGSAIAAFTLPSFAIAAVLVHLGIIMFDNMTTT 485


>SPAC6G9.05 |pcd1||coenzyme A diphosphatase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 285

 Score = 25.0 bits (52), Expect = 9.6
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +3

Query: 90  HQYFLMTLSRSTIVSKPTLQTTDF 161
           HQ +L+  +R T+  KPT Q T F
Sbjct: 93  HQIYLLHKNRPTLPLKPTNQPTRF 116


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,800,824
Number of Sequences: 5004
Number of extensions: 58906
Number of successful extensions: 124
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 116
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 124
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 297805304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).