SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1322.15 |rpl3402|rpl34, rpl34-2|60S ribosomal protein L34|Sc...    27   2.1  
SPAC23A1.08c |rpl3401|rpl34, rpl34-1|60S ribosomal protein L34|S...    27   2.7  
SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharom...    25   6.3  
SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual        25   8.3  

>SPCC1322.15 |rpl3402|rpl34, rpl34-2|60S ribosomal protein
           L34|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 111

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -3

Query: 123 T*QRALGTN*RGNELRMLALTGTNVRY*H 37
           T +R L  N R N+ R++   G N+RY H
Sbjct: 6   TYRRRLAYNTRSNKTRIIKTPGNNIRYLH 34


>SPAC23A1.08c |rpl3401|rpl34, rpl34-1|60S ribosomal protein
           L34|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 112

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = -3

Query: 123 T*QRALGTN*RGNELRMLALTGTNVRY*H 37
           T +R L  N R N  R++   G N+RY H
Sbjct: 6   TYRRRLAYNTRSNRTRIIKTPGNNIRYLH 34


>SPBC211.03c |||guanyl-nucleotide exchange
           factor|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1462

 Score = 25.4 bits (53), Expect = 6.3
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +2

Query: 416 IRVPRAGAREEPDCQAASFSFVLNPL 493
           + VPRA   +EP C  +  S V+N +
Sbjct: 1   MEVPRASPNQEPLCSISPSSLVINEI 26


>SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 4717

 Score = 25.0 bits (52), Expect = 8.3
 Identities = 15/60 (25%), Positives = 28/60 (46%)
 Frame = +1

Query: 49  NVRAG*SEHP*FISPLVRS*CPLLSSRGLDSVTSETLNIFSCGSCRRKVVELRVWFLSDL 228
           N+    SE    + PL+     ++ SRG       +  +F+  S + K++  R+W + DL
Sbjct: 227 NIEHAPSEVLSVLLPLLEKRQLVIPSRGETIYAKGSFQMFATSSMKTKILGQRLWQILDL 286


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,381,744
Number of Sequences: 5004
Number of extensions: 45214
Number of successful extensions: 119
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 105
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 119
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 258201856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).