SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23C11.02c |rps23||40S ribosomal protein S23|Schizosaccharomy...    84   2e-17
SPBP4H10.13 |rps2302|rps23-2|40S ribosomal protein S23|Schizosac...    84   2e-17
SPAC4F8.06 |||mitochondrial ribosomal protein subunit S12|Schizo...    37   0.002
SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|c...    27   2.6  
SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyce...    26   4.5  
SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyce...    26   4.5  
SPCC550.08 |||N-acetyltransferase |Schizosaccharomyces pombe|chr...    25   6.0  

>SPAC23C11.02c |rps23||40S ribosomal protein S23|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 143

 Score = 83.8 bits (198), Expect = 2e-17
 Identities = 38/52 (73%), Positives = 45/52 (86%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N ++ENDEVL++GFGRKG A GDIPGVRFKVVKVA V L AL+ EKKE+PR+
Sbjct: 92  NFVDENDEVLLSGFGRKGKAKGDIPGVRFKVVKVAGVGLSALFHEKKEKPRA 143



 Score = 81.4 bits (192), Expect = 9e-17
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  +EK+GVEAKQPNSAIRKCVRVQLIKNGKKVTAFVP DGC
Sbjct: 49  GIVVEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPHDGC 90


>SPBP4H10.13 |rps2302|rps23-2|40S ribosomal protein
           S23|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 143

 Score = 83.8 bits (198), Expect = 2e-17
 Identities = 38/52 (73%), Positives = 45/52 (86%)
 Frame = -3

Query: 253 NHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKKERPRS 98
           N ++ENDEVL++GFGRKG A GDIPGVRFKVVKVA V L AL+ EKKE+PR+
Sbjct: 92  NFVDENDEVLLSGFGRKGKAKGDIPGVRFKVVKVAGVGLSALFHEKKEKPRA 143



 Score = 81.4 bits (192), Expect = 9e-17
 Identities = 37/42 (88%), Positives = 39/42 (92%)
 Frame = -1

Query: 381 GPPLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGC 256
           G  +EK+GVEAKQPNSAIRKCVRVQLIKNGKKVTAFVP DGC
Sbjct: 49  GIVVEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPHDGC 90


>SPAC4F8.06 |||mitochondrial ribosomal protein subunit
           S12|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 146

 Score = 36.7 bits (81), Expect = 0.002
 Identities = 17/33 (51%), Positives = 24/33 (72%)
 Frame = -1

Query: 357 VEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDG 259
           V+ K+PNSA+RK  RV+L   G+ VTA++P  G
Sbjct: 61  VKPKKPNSAVRKVARVRL-STGRSVTAYIPGIG 92


>SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 658

 Score = 26.6 bits (56), Expect = 2.6
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = +2

Query: 503 RSGVIAEEAPHRS 541
           RSG I EEAPHRS
Sbjct: 633 RSGTIREEAPHRS 645


>SPCP1E11.11 |||Puf family RNA-binding protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 642

 Score = 25.8 bits (54), Expect = 4.5
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = -1

Query: 366 KVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPRDGCQTTSKKTTK 229
           K   E K+ + ++ K  RV++ K  KKV +F P+    TTS  +++
Sbjct: 7   KESTEVKKKDGSMNK--RVKVAKLPKKVDSFSPKKKKNTTSSGSSE 50


>SPAC30D11.11 |||Haemolysin-III family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 442

 Score = 25.8 bits (54), Expect = 4.5
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +2

Query: 5   HNIYYVLGFYIL*TYKQRASRQQVTYHNVHL*SWSLLFLFVESEERHVGYFYHLKTN--S 178
           HN  Y++  Y   T K++  R  +++HN     W+ L  F+      + YFY   ++  S
Sbjct: 179 HNNPYIIRGYRFYTSKRKCFRSILSWHNETFNIWTHLSAFIVF-FAVLAYFYPSSSSWVS 237

Query: 179 GNVTDGV 199
            NV++ +
Sbjct: 238 SNVSNRI 244


>SPCC550.08 |||N-acetyltransferase |Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 247

 Score = 25.4 bits (53), Expect = 6.0
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +2

Query: 101 SWSLLFLFVESEERHVGYFYHLKTNSGNVTD--GVTFTTESRH 223
           SW L+++ V S+E+  GY   L     N+ D  G+    ES H
Sbjct: 129 SWYLVYVGVSSKEQGKGYLRKLIEPIFNICDQEGLPIYLESSH 171


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,475,705
Number of Sequences: 5004
Number of extensions: 51872
Number of successful extensions: 130
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 126
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 130
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 244081442
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).