SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0012
         (588 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC16H5.08c |||ribosome biogenesis ATPase, Arb family |Schizosa...    75   1e-14
SPBC29A3.09c |||AAA family ATPase Gcn20 |Schizosaccharomyces pom...    71   1e-13
SPCC825.01 |||ribosome biogenesis ATPase, Arb family |Schizosacc...    61   1e-10
SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces po...    48   8e-07
SPCC417.08 |tef3||translation elongation factor eEF3|Schizosacch...    46   5e-06
SPAC20G4.01 ||SPAC22F8.13|CCR4-Not complex subunit Caf16|Schizos...    38   8e-04
SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|ch...    34   0.013
SPBC25B2.02c |mam1|SPBC2G5.09c|M-factor transporter Mam1 |Schizo...    29   0.38 
SPAC15A10.01 |atm1|SPAC8C9.18|ABC family iron transporter Atm1|S...    29   0.50 
SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe...    29   0.67 
SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc...    28   0.88 
SPAC6F6.03c |||ribosome export GTPase|Schizosaccharomyces pombe|...    27   2.0  
SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr...    27   2.7  
SPAC17H9.06c |||conserved fungal protein|Schizosaccharomyces pom...    27   2.7  
SPAP8A3.11c |||mitochondrial GTPase Mtg2|Schizosaccharomyces pom...    26   3.5  
SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces ...    26   4.7  
SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch...    25   6.2  
SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||...    25   8.2  
SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces ...    25   8.2  
SPAC821.12 |orb6||serine/threonine protein kinase Orb6|Schizosac...    25   8.2  
SPAC10F6.09c |psm3|smc3|mitotic cohesin complex subunit Psm3|Sch...    25   8.2  

>SPBC16H5.08c |||ribosome biogenesis ATPase, Arb family
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 618

 Score = 74.5 bits (175), Expect = 1e-14
 Identities = 33/67 (49%), Positives = 50/67 (74%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRDIKI +++++F+G  L+++  +ELN G+RYGL+G NG GKS+ L ++  R+V  PE
Sbjct: 71  PMSRDIKIDSYTLSFHGRLLIENATIELNHGQRYGLLGDNGSGKSTFLESVAARDVEYPE 130

Query: 431 HIDIFHL 451
           HID + L
Sbjct: 131 HIDSYLL 137



 Score = 28.3 bits (60), Expect = 0.88
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = +2

Query: 308 LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           L +D    ++   R  +VG NG GKS+LL  +    +PI  ++
Sbjct: 405 LYRDLSFGIDMDSRVAIVGKNGTGKSTLLNLITGLLIPIEGNV 447


>SPBC29A3.09c |||AAA family ATPase Gcn20 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 736

 Score = 71.3 bits (167), Expect = 1e-13
 Identities = 35/65 (53%), Positives = 41/65 (63%)
 Frame = +2

Query: 257 SRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           S+DIKI    + F G  +L    L L  GRRYGL G NG GKS+LL AL RRE+ IP HI
Sbjct: 180 SKDIKIDGIDLAFAGHRILTGASLTLAQGRRYGLTGRNGIGKSTLLRALSRREIAIPTHI 239

Query: 437 DIFHL 451
            I H+
Sbjct: 240 TILHV 244



 Score = 29.1 bits (62), Expect = 0.50
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 299 GSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           G  +L+   +++    R G+VG NG GKS++L  L
Sbjct: 530 GHPILKHVDIDVQMDSRIGVVGPNGAGKSTMLKLL 564


>SPCC825.01 |||ribosome biogenesis ATPase, Arb family
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 822

 Score = 61.3 bits (142), Expect = 1e-10
 Identities = 29/69 (42%), Positives = 44/69 (63%)
 Frame = +2

Query: 251 PCSRDIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPE 430
           P SRD+++   S++ +G  L++D+ L L  GRRYGL+  NG GKS+LL A+    +P P 
Sbjct: 271 PNSRDLQVEKLSVSAWGKLLIKDSELNLINGRRYGLIAPNGSGKSTLLHAIACGLIPTPS 330

Query: 431 HIDIFHLTR 457
            +D + L R
Sbjct: 331 SLDFYLLDR 339



 Score = 26.2 bits (55), Expect = 3.5
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTL-LELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           IK  + S  + G   +   L   L+   R  LVG NG GK++L+  +  +  P
Sbjct: 594 IKFQDVSFNYPGGPTIFSKLNFGLDLKSRVALVGPNGAGKTTLIKLILEKVQP 646


>SPAC3C7.08c |elf1||AAA family ATPase ELf1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1057

 Score = 48.4 bits (110), Expect = 8e-07
 Identities = 26/56 (46%), Positives = 35/56 (62%), Gaps = 3/56 (5%)
 Frame = +2

Query: 278 NFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREV---PIPEHI 436
           +FS+ + G  LL  T L L  G RYG+VG NGCGKS+LL A+   +V   P P+ +
Sbjct: 449 DFSLAYGGRLLLSHTNLHLYRGHRYGVVGHNGCGKSTLLRAIGDYKVENFPSPDEV 504



 Score = 29.5 bits (63), Expect = 0.38
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           +K+ N S T+  ++   L +  + L+   R  ++G NG GKS+L+  L    +P
Sbjct: 692 LKMTNASYTYPNAKKKSLDNVTVGLSLSSRVAILGPNGAGKSTLIKVLIGEVIP 745


>SPCC417.08 |tef3||translation elongation factor
           eEF3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1047

 Score = 45.6 bits (103), Expect = 5e-06
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP-IPEHI 436
           D+    FS+ +    LL  T L L  GRRYGL G NG GKS+L+ A+   +V   P H+
Sbjct: 434 DLCNCEFSLAYGAKILLNRTRLRLKRGRRYGLCGPNGSGKSTLMRAIVNGQVEGFPTHL 492



 Score = 30.7 bits (66), Expect = 0.16
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +2

Query: 266 IKIANFSITFYGSEL--LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVP 421
           IK+ + S  + G+    L D   +++   R  ++G NG GKS+L+  L    +P
Sbjct: 673 IKVQHMSFQYPGTSKPQLNDISFQVSLSSRIAVIGPNGAGKSTLIKVLTGELLP 726


>SPAC20G4.01 ||SPAC22F8.13|CCR4-Not complex subunit
           Caf16|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 280

 Score = 38.3 bits (85), Expect = 8e-04
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 3/105 (2%)
 Frame = +2

Query: 263 DIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHI 436
           ++ ++N S TF   +   L    L+L  G R  LVG NG GKS+LL  L  + +    HI
Sbjct: 2   EVTVSNLSYTFSPKQPLSLDHVTLDLPKGSRTLLVGANGAGKSTLLKLLSGKSLAKAGHI 61

Query: 437 DIFHLTRGGARYPIRPIVSRITIHGRRF-TNVVTGKTLAFPNLIA 568
            +      G + P R   S     G  +  N V  + ++   LIA
Sbjct: 62  SV------GGKDPFRESSSAFVYLGTEWVNNPVIHRDMSVARLIA 100


>SPAC323.04 |||mitochondrial ATPase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 487

 Score = 34.3 bits (75), Expect = 0.013
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +2

Query: 266 IKIANFSITFYGSELLQDTLLELNCGRRYGLVGLNGCGKSSLLA 397
           I + + +  ++G ++L D    +  G R+ L G NG GK++LLA
Sbjct: 265 ISMEHLNCVYWGRKVLSDINWTIREGERWALTGSNGSGKTTLLA 308


>SPBC25B2.02c |mam1|SPBC2G5.09c|M-factor transporter Mam1
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1336

 Score = 29.5 bits (63), Expect = 0.38
 Identities = 15/48 (31%), Positives = 26/48 (54%)
 Frame = +2

Query: 311  LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDIFHLT 454
            L +  L +    +  +VG++G GKS+L+  LR+       +ID + LT
Sbjct: 1118 LNNVSLSIEAREKVAIVGISGSGKSTLVELLRKTYPSEDIYIDGYPLT 1165


>SPAC15A10.01 |atm1|SPAC8C9.18|ABC family iron transporter
           Atm1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 693

 Score = 29.1 bits (62), Expect = 0.50
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 8/62 (12%)
 Frame = +2

Query: 248 APCSRDIKIANFSITF------YGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAAL 403
           AP +RD+ +   SI F      Y     +L      +  G +   VG +GCGKS++L  L
Sbjct: 430 APDARDLVLKGGSIQFDNVHFSYNPNRPILNGCSFNIPAGAKVAFVGASGCGKSTILRLL 489

Query: 404 RR 409
            R
Sbjct: 490 FR 491


>SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe|chr
            2|||Manual
          Length = 1465

 Score = 28.7 bits (61), Expect = 0.67
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 311  LQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEHIDI 442
            L +  +E++   + G+VG  G GKS+L  AL R   P    I+I
Sbjct: 1243 LNNINIEISPREKIGIVGRTGAGKSTLAMALFRIIEPTEGKIEI 1286


>SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase
            Abc2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1463

 Score = 28.3 bits (60), Expect = 0.88
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRRREVPI 424
            P    IK  ++S+ +  +   +L D  + +    + G+VG  G GKS+L  AL R   P 
Sbjct: 1219 PSHGAIKFDHYSVRYRENLPLVLNDISVNIKPQEKIGIVGRTGAGKSTLTLALFRLIEPT 1278

Query: 425  PEHIDI 442
               I +
Sbjct: 1279 SGDIQL 1284



 Score = 26.2 bits (55), Expect = 3.5
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
 Frame = +2

Query: 263 DIKIANFSITFYGSELLQDTLLELNCGRRYG----LVGLNGCGKSSLLAA 400
           +IK   FS +  G    + TL +++   R G    +VG  G GKSSLL A
Sbjct: 579 EIKKGTFSWSGPGQNAAEPTLRDIDFVARRGELCCIVGKVGMGKSSLLEA 628


>SPAC6F6.03c |||ribosome export GTPase|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 537

 Score = 27.1 bits (57), Expect = 2.0
 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 4/29 (13%)
 Frame = +2

Query: 353 GLVGLNGCGKSSLLAALRRREV----PIP 427
           GL+G    GKSS++  LR+++V    PIP
Sbjct: 314 GLIGFPNAGKSSIINTLRKKKVCNVAPIP 342


>SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 593

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = +2

Query: 341 GRRYGLVGLNGCGKSSLLAALRRREVP 421
           G+  GLVG NG GKS+ L  L  +  P
Sbjct: 103 GQVLGLVGTNGIGKSTALKILSGKMKP 129


>SPAC17H9.06c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 601

 Score = 26.6 bits (56), Expect = 2.7
 Identities = 13/52 (25%), Positives = 27/52 (51%)
 Frame = -1

Query: 564 IKLGNARVFPVTTFVKRRP*IVIRLTIGRIGYRAPPRVRWNMSMCSGIGTSR 409
           ++  + + +P+T FVKR+  +V++   G +   +  R R N  +     +SR
Sbjct: 8   VQRNDVQKYPITRFVKRKSNVVLKKNKGAMKSNSNSRSRGNKKLKESQFSSR 59


>SPAP8A3.11c |||mitochondrial GTPase Mtg2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 419

 Score = 26.2 bits (55), Expect = 3.5
 Identities = 15/36 (41%), Positives = 19/36 (52%)
 Frame = +2

Query: 326 LELNCGRRYGLVGLNGCGKSSLLAALRRREVPIPEH 433
           LEL      GLVGL   GKS+LL  L   +  + E+
Sbjct: 231 LELKTICEIGLVGLPNAGKSTLLNCLTASKSKVGEY 266


>SPCC737.03c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 615

 Score = 25.8 bits (54), Expect = 4.7
 Identities = 15/35 (42%), Positives = 21/35 (60%)
 Frame = -3

Query: 379 STPIKSD*PISSPTIQLQESILK*LTPIESN*KVS 275
           S+P++   P+  PT+QLQ S L  L P E   KV+
Sbjct: 437 SSPVR---PMLKPTLQLQNSPLSKLVPQEVGNKVN 468


>SPCC663.03 |pmd1||leptomycin efflux transporter
            Pmd1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1362

 Score = 25.4 bits (53), Expect = 6.2
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = +2

Query: 305  ELLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            ++L+   L +  G+    VG +GCGKS+ +  + R
Sbjct: 1135 KVLRGLNLTVKPGQFVAFVGSSGCGKSTTIGLIER 1169


>SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 710

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = -3

Query: 541 FPSHNVCKTTAVNCNTTHYRANWVPGPPSSQ 449
           FPS N  KT     N T  +  W+ G P+ +
Sbjct: 300 FPSENANKTQINIENATCSKMTWIMGSPTKE 330


>SPAC9E9.12c |ybt1|abc1|ABC transporter Ybt1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1427

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 251  PCSRDIKIANFSITFYGSE--LLQDTLLELNCGRRYGLVGLNGCGKSSLLAALRR 409
            P    + I N ++++   +  +L+D  LE+    +  +VG  G GKS++   L R
Sbjct: 1175 PTLGHVSIKNLTVSYSIGQAAVLEDINLEILPKEKIAIVGRTGSGKSTMGLTLLR 1229


>SPAC821.12 |orb6||serine/threonine protein kinase
           Orb6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 469

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 9/20 (45%), Positives = 10/20 (50%)
 Frame = +1

Query: 529 CDWENPGVPQLNCLAGHSPF 588
           CDW + G     CL G  PF
Sbjct: 313 CDWWSLGAIMFECLIGWPPF 332


>SPAC10F6.09c |psm3|smc3|mitotic cohesin complex subunit
           Psm3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1194

 Score = 25.0 bits (52), Expect = 8.2
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +2

Query: 356 LVGLNGCGKSSLLAALR 406
           +VG NG GKS+  AA+R
Sbjct: 30  IVGRNGSGKSNFFAAIR 46


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,294,829
Number of Sequences: 5004
Number of extensions: 44655
Number of successful extensions: 256
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 256
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 254167452
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).