SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0010
         (539 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc...    29   0.58 
SPAC139.01c ||SPAC955.02c|nuclease, XP-G family|Schizosaccharomy...    29   0.58 
SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2 |Schizosacc...    26   3.1  
SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase |Schizosaccharom...    25   7.2  

>SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence
           orphan|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 776

 Score = 28.7 bits (61), Expect = 0.58
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = +1

Query: 169 ENILSQLLNYIFQSNQILSLMSCACCVKSYV 261
           E+I    LN+I   NQ +  M C    KSYV
Sbjct: 58  EDIFQDFLNFIITKNQEMFSMDCNSICKSYV 88


>SPAC139.01c ||SPAC955.02c|nuclease, XP-G family|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 802

 Score = 28.7 bits (61), Expect = 0.58
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 142 DFKLLCSQGENILSQLLNYIFQSNQILSL 228
           D + + SQG N+L+Q LN  +Q+  I+SL
Sbjct: 437 DLEEIWSQGLNLLTQPLNRFYQARDIVSL 465


>SPBC4.04c |mcm2|cdc19, nda1|MCM complex subunit Mcm2
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 830

 Score = 26.2 bits (55), Expect = 3.1
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = -2

Query: 241 MHSSLRTRFDYFEKCNSTIDLRCFHLDCII 152
           +HS +  R      C +  DLR  HL+C++
Sbjct: 282 IHSDIHVRITNLPTCFTLRDLRQSHLNCLV 311


>SPBPB2B2.11 |||nucleotide-sugar 4,6-dehydratase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 365

 Score = 25.0 bits (52), Expect = 7.2
 Identities = 14/57 (24%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +1

Query: 43  HSIKINSKTNVSRKYMSIYQISEC*ILTTQNIVD-FKLLCSQGENILSQLLNYIFQS 210
           H I   ++++V R ++     ++  IL+TQN+++  ++L  + E + ++ LN++  S
Sbjct: 93  HIINFAAESSVDRSFIDPLYFTKNNILSTQNLLECVRILLGKKEELRNR-LNFVHVS 148


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,022,847
Number of Sequences: 5004
Number of extensions: 38269
Number of successful extensions: 58
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 58
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 221892220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).