SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce...    27   2.8  
SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16 |Schizosa...    25   6.5  
SPBC428.11 |||homocysteine synthase |Schizosaccharomyces pombe|c...    25   8.6  

>SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 698

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +1

Query: 559 YRKTWTGLLLKLPW 600
           YRK W GL + LPW
Sbjct: 465 YRKEWNGLTVILPW 478


>SPCC4G3.19 |alp16||gamma tubulin complex subunit Alp16
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 759

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 12/20 (60%), Positives = 14/20 (70%)
 Frame = +3

Query: 333 NGV*DYR*EFKSNLLLYDFR 392
           NGV  YR EF+  L LY+FR
Sbjct: 264 NGVLQYRKEFQRWLRLYEFR 283


>SPBC428.11 |||homocysteine synthase |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 429

 Score = 25.0 bits (52), Expect = 8.6
 Identities = 13/37 (35%), Positives = 16/37 (43%)
 Frame = +2

Query: 476 SNKWNWTKNRKAFSTQPGPLKVYSGFGYTVKHGPDCY 586
           S K++W KN K F     P   Y G  +T   G   Y
Sbjct: 226 SGKFDWKKNSKRFPEFNEPHPGYHGMVFTETFGNLAY 262


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,599,046
Number of Sequences: 5004
Number of extensions: 52951
Number of successful extensions: 111
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 109
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 111
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 266270664
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).