SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||...    27   2.5  
SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc...    26   4.4  
SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom...    25   7.7  

>SPAC29A4.19c |||P-type ATPase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1096

 Score = 26.6 bits (56), Expect = 2.5
 Identities = 11/38 (28%), Positives = 20/38 (52%)
 Frame = -1

Query: 159 NPFHLYFILKVFHSYCCNFIKKTCIFYFVSCFIYIFSV 46
           +PF+L+  + V    C +F+  +C   F+S +    SV
Sbjct: 201 HPFYLFQAVSVLIWLCDSFVFYSCCIVFISSYSIFLSV 238


>SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase
           Abc2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1463

 Score = 25.8 bits (54), Expect = 4.4
 Identities = 9/28 (32%), Positives = 18/28 (64%)
 Frame = -3

Query: 307 YYSSYKA*NVYIIFCYILLCTGTSGLTI 224
           Y++ +KA ++++IF Y L   G  G+ +
Sbjct: 891 YWTYFKACSLFLIFLYFLFIIGGIGMNV 918


>SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1375

 Score = 25.0 bits (52), Expect = 7.7
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = -3

Query: 103 HKKNMHILFCVVFYIYFFCSVIYFSL*LFKYEKK 2
           H  ++ + + ++  IYFF +  YFSL   K+E +
Sbjct: 684 HFIHLRVWYVLLHKIYFFIASAYFSLKNEKFENE 717


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,349,419
Number of Sequences: 5004
Number of extensions: 49365
Number of successful extensions: 116
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 116
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 238029836
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).