SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   140   1e-34
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    71   1e-13
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...    56   3e-09
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    46   3e-06
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...    42   5e-05
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    37   0.002
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    37   0.003
SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces p...    31   0.13 
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    30   0.22 
SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    28   1.2  
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    27   1.6  
SPCC736.15 |||protein kinase inhibitor |Schizosaccharomyces pomb...    27   2.1  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    26   3.7  
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    26   4.8  
SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces p...    25   6.4  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  140 bits (340), Expect = 1e-34
 Identities = 73/131 (55%), Positives = 83/131 (63%)
 Frame = +2

Query: 92  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAK 271
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVG   ++K
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             PEEHP LLTEAPLNPK+   KMT 
Sbjct: 62  RGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREKMTQ 121

Query: 452 IMFPKHFTRPA 484
           I+F + F  PA
Sbjct: 122 IIF-ETFNAPA 131



 Score =  100 bits (239), Expect = 2e-22
 Identities = 56/106 (52%), Positives = 63/106 (59%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIV NWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 57  EAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNR 116

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF  P    V IQ VL  +   R      DS  G++
Sbjct: 117 EKMTQI-IFETFNAPAF-YVAIQAVLSLYASGRTTGIVLDSGDGVT 160


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 71.3 bits (167), Expect = 1e-13
 Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 1/118 (0%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG   +        
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQNLRGLLKI 71

Query: 290 XXXXXXXXXLTGMTWRR-FGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                             +  I S     + PEEHP+LLTE PL     + K+    +
Sbjct: 72  QRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNKEKIAEYFY 129



 Score = 50.4 bits (115), Expect = 2e-07
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +1

Query: 253 SEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYN-ELGVAPRGTP 393
           SEAQ+ RG L ++ PIE GI+ NW DME+IW + + + +L   P   P
Sbjct: 60  SEAQNLRGLLKIQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHP 107


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score = 56.4 bits (130), Expect = 3e-09
 Identities = 40/126 (31%), Positives = 52/126 (41%), Gaps = 2/126 (1%)
 Frame = +2

Query: 98  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGVRHRAK 271
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VG    A 
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAV 61

Query: 272 XXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTH 451
                                 +             P    +LLTE P+NP A   KM  
Sbjct: 62  RSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCE 121

Query: 452 IMFPKH 469
            MF ++
Sbjct: 122 TMFERY 127



 Score = 54.0 bits (124), Expect = 2e-08
 Identities = 23/76 (30%), Positives = 44/76 (57%)
 Frame = +1

Query: 214 RDGRYGTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           + G    + ++   EA++ R  L +KYP+E+GI+ ++++M ++W +TF+ +L + PRG  
Sbjct: 43  KTGNVQIKDVMVGDEAEAVRSLLQVKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRK 102

Query: 394 SPAH*GSPQPQGHREK 441
                    P  +REK
Sbjct: 103 ILLTEPPMNPVANREK 118


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 46.4 bits (105), Expect = 3e-06
 Identities = 34/122 (27%), Positives = 52/122 (42%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKX 274
           +EV+A+V+D GS   + GF+G+D P+ V PS  G       + G    + Y+   +    
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCGEFSDGRRLFG----EEYIYKSNPGME 64

Query: 275 XXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHI 454
                         +T   W R+G+        + P EHP+L+TE   NP     K    
Sbjct: 65  IKNAIRNGWVENWDVTVDLW-RYGL---EQQLKTNPLEHPILITEPFDNPPENRVKTLET 120

Query: 455 MF 460
           MF
Sbjct: 121 MF 122



 Score = 25.4 bits (53), Expect = 6.4
 Identities = 11/38 (28%), Positives = 17/38 (44%)
 Frame = +1

Query: 280 LTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTP 393
           + +K  I +G V NWD    +W +    +L   P   P
Sbjct: 63  MEIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHP 100


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 42.3 bits (95), Expect = 5e-05
 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKDSYV 250
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G  +  K SY+
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIA-TRSAGASSGPAVSSKPSYM 55



 Score = 39.9 bits (89), Expect = 3e-04
 Identities = 14/33 (42%), Positives = 19/33 (57%)
 Frame = +1

Query: 283 TLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAP 381
           +L YPI HG + NWD ME+ W  + +  L   P
Sbjct: 89  SLDYPIRHGQIENWDHMERFWQQSLFKYLRCEP 121



 Score = 32.7 bits (71), Expect = 0.042
 Identities = 14/27 (51%), Positives = 15/27 (55%)
 Frame = +2

Query: 380 PEEHPVLLTEAPLNPKATERKMTHIMF 460
           PE+H  LLTE PLNP         IMF
Sbjct: 121 PEDHYFLLTEPPLNPPENRENTAEIMF 147


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 37.1 bits (82), Expect = 0.002
 Identities = 27/117 (23%), Positives = 48/117 (41%)
 Frame = +2

Query: 110 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHRAKXXXXXX 289
           LV+DNGS   +AG+ G+  P+ VF ++V R R +     + +  + VG     +      
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYRDR----KLSRTSTLVGNDTLIEVGSRSI 82

Query: 290 XXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMF 460
                    ++        +  + +       EHP+ +TE   NP      MT ++F
Sbjct: 83  ARSPFERNVISNWDLMEQVLDYTFLKLGIDRMEHPICMTEPLANPTYVRSTMTELLF 139



 Score = 29.9 bits (64), Expect = 0.30
 Identities = 11/27 (40%), Positives = 19/27 (70%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTFYNELGV 375
           P E  +++NWD ME++  +TF  +LG+
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGI 111


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +2

Query: 95  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 196
           EE+ +LV+D GS   + G+AG+++P  + PS  G
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPSYYG 41


>SPAC13F5.04c |||endosomal sorting protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 277

 Score = 31.1 bits (67), Expect = 0.13
 Identities = 20/66 (30%), Positives = 29/66 (43%)
 Frame = -1

Query: 327 IPVSDDSVFDGVFEGQETSFALCLTPT*ESFCPIPTITP*WRGLPTIEGNTARGASSPAK 148
           +P  + +V        ETSFAL  T    S    PT +      P +E +    +S+PA 
Sbjct: 63  LPTQEAAVETNASASHETSFALPTTSPAASLSISPTKSAAVSSEPNVEADVKSLSSTPAA 122

Query: 147 PALHIP 130
           P L+ P
Sbjct: 123 PQLNSP 128


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 30.3 bits (65), Expect = 0.22
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 1/57 (1%)
 Frame = -1

Query: 258 LTPT*ESFCPI-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 91
           + PT  S  P+ PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 399 IPPTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455


>SPAC688.12c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 167

 Score = 27.9 bits (59), Expect = 1.2
 Identities = 9/27 (33%), Positives = 18/27 (66%)
 Frame = +1

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLL 516
           E++ PY ++KTF  P++  +G+   L+
Sbjct: 3   EEESPYQLTKTFSNPKNNKIGLAIFLI 29


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 13/27 (48%), Positives = 15/27 (55%)
 Frame = -2

Query: 254 LLHKSPSVPYRPSRPDGGAFPRSRGTR 174
           L+ K+PS PY  SRP   A   S  TR
Sbjct: 309 LISKAPSYPYSSSRPSASASLASSPTR 335


>SPCC736.15 |||protein kinase inhibitor |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 351

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 10/33 (30%), Positives = 20/33 (60%)
 Frame = -1

Query: 594 EKTPVPPGKSKPRIPGWVTAPKRCKSKKHGLNA 496
           + TPV PG+++P   G+ T+ +     +H L++
Sbjct: 228 DDTPVTPGEARPAYDGYETSRQIVMDAEHALSS 260


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 13/31 (41%), Positives = 16/31 (51%)
 Frame = -1

Query: 231 PIPTITP*WRGLPTIEGNTARGASSPAKPAL 139
           P+PT  P    LPT   NT +    P+ PAL
Sbjct: 74  PVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 25.8 bits (54), Expect = 4.8
 Identities = 7/21 (33%), Positives = 13/21 (61%)
 Frame = +1

Query: 295 PIEHGIVTNWDDMEKIWHHTF 357
           PI+ G V +W+ ++  W H +
Sbjct: 113 PIQRGRVVDWEALKAFWKHLY 133


>SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 411

 Score = 25.4 bits (53), Expect = 6.4
 Identities = 9/35 (25%), Positives = 21/35 (60%)
 Frame = +2

Query: 359 TMSWVSPPEEHPVLLTEAPLNPKATERKMTHIMFP 463
           T++  SPPE+ P++  +  +NP+    +++ +  P
Sbjct: 277 TLTTASPPEQIPLMEPQVYVNPQVLPGRLSSLSKP 311


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,867,417
Number of Sequences: 5004
Number of extensions: 68630
Number of successful extensions: 197
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 195
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 262236260
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).